Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162776-GRMZM2G178859
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193223
Function (paralog2):hypothetical protein LOC100274057

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.5592136676974
Log2 mRNA fold difference:-0.3328762161104
Log2 TE fold difference:-0.23134442195725
Sequences
Protein sequence

MWRGGATTAFVARALRSRLLLDPIHHPVTSLAPISSARTSSSSTSSTAAANTIVEEAAVA
AAVSVSQHTGSISDALRHYGKCYRELSKVRLSALVVATSGAGYVLGSGNIVDIAGLCCTC
AGTMMVAASANTLNQLPPQNNSVFSLINNNAYFQVFEIKNDAKMKRTMRRPLPSGRISPA
HAAMWATSVGVAGTALLAWKANGLAAGLAASNLVLYAFVYTPLKQIHPVNTWVGAIVGAI
PPLLGWAAASTELSLNAMILPAALYYWQIPHFMALAYLCRNDYLAGGYRMFSFADPTGKR
TAWVSLRNCLYMLPLGLFAYNWGLTSEWFSFEASLLTLGLTIGSLSFVLKPSPKTARRMF
YGSLLYLPAFMAGLLLHRLPNEQKAHNLAEKSELDGVLYGADLQDKERATQKRQDRNPSS
MQSRPPVAYASVAPFPFLPVPIYDS*

MWRGGSTAASAARALRSRLLLDPIHHPATSLAPIASARTSSSSTPSTAAANTIVEEAAAA
VSVSQHTGSISDSLRHYGKCYWELSKARLSALVVATSGAGYVLGSGNIVDIAGLCCTCAG
TMMVAASANTLNQVFEIKNDAKMKRTMRRPLPSGRISPAHAAMWATSVGVAGTALLAWKA
NGLAAGLAASNLVLYAFVYTPLKQIHPVNTWVGAVVGAIPPLLGWAAASTELSLNAMILP
AALYFWQIPHFMALAYLCRNDYLAGGYRMFSFADPTGRRTAWVSLRNCLYMLPLGLFAYN
WGLTSEWFSFEASLLTLGLTIGALSFVLEPSPKTARRMFYGSLLYLPAFMSGLLLHRLPS
EQKAHNLAENNELDGVLYGADLQDEERARQKRQDTKPSRVQSLPPVSYASVAPFPFLPVP
IYES*

Other information
Ka divergence:-0.0833091KaKs divergence:0.0598291
GC content 1 (%):51GC content 2 (%):53GC content divergence:0.019
Length 1 (bp):1338Length 2 (bp):1275Length divergence:-0.024
MFE 1 (kcal):-470.73MFE 2 (kcal):-467.42MFE divergence-0.004