Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162814-GRMZM2G178847
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274922
Function (paralog2):hypothetical protein LOC100274633

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.15947988128734
Log2 mRNA fold difference:0.9617589222348
Log2 TE fold difference:-0.81456920631848
Sequences
Protein sequence

MENLKEQRGHDAAGANAWMTVPAFGDWDTKNGALPDYSMDFSKIREMRKQNKKELSRASL
GGDDDLLAHAQKPQPSIAPPKLGRPRPGPADDHSPTGGKKFLSYFRCCIKA*

MDNLKESSHRALVRACVQQRGHDAAGANSGVWMTVPAFGDWDTKNGALPDYSMDFSKIRE
TRKQNKKELSRASLGGDDDLFAHAHAHAQKPQANSAQPKLGRPCPAADRRPLHARDHSPT
GGKKFLSYFQCCIKA*

Other information
Ka divergence:-0.305483KaKs divergence:-0.257126
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):336Length 2 (bp):408Length divergence:0.097
MFE 1 (kcal):-139.14MFE 2 (kcal):-168.92MFE divergence0.097