Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162954-GRMZM2G346701
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100216861
Function (paralog2):hypothetical protein LOC100383296

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.94690012059585
Log2 mRNA fold difference:-1.9654434213172
Log2 TE fold difference:1.0815598249404
Sequences
Protein sequence

METADYSGKLFVGGISWETDEDRLREYFGRFGEVTEAVIMRDRSTGRARGFGFVVFADAT
VAERVTIEKHMIDGRMVEAKKAVPRDDHSIVSKSNTSSIGSPGPGRTRKIFVGGLPSNVT
EADFRGYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKALHKSFHELNGKMVEV
KKAVPKEQSPGPVARSPAGVGQNYAMNRVHSFLNDFNQGYNPNPIGGYGMRVDGRFGQLS
GARNGLSSFGPGYGMGMNVEGGMSGTFGANSGFISNSNGRQMGSYFNGSSNRLSSSIGYL
GYDSGSMLSSMSRNFNAGVNYPINPTNMSAFAALGNGGGVNYMGLPSIAPELAQLGNISS
LGSGNFSRGAGVNNLSLPSGSYGRSNSTGTIGEPFSASGNAYEVNNPDTYGNSSIYGGTS
WRFPSSEVDVPSFSHDLGNVDPNMKSDISANYMGNYSVSNNQPSRGITS*

MRGEEAGAMEAADYGKLFVGGISWETSEDRLREYFGRFGEVTEAAIMRDRSTGRARGFGF
VVFTDAAVAERVTMEKHMIDGRMVEAKKAVPRDDHSIVSKSNGRSTGSPGPGRTRKIFVG
GLPSSITEADFRRYFEQFGVITDVVKKAVPKEQSPGPVARSPVGVGQNYAANRVHSFLNG
FNQGYNPIPMGGYGMRVDGRYGFLSGARNGFSSFGPGYGMGMNVEGGMSGTFGATSGFIS
NSNGRQMGSYFNASSNRLGSPIGYLGLNDVPGSMLGSMSRNVWGNGSLNYPSNPANMSAF
ASPGNGGQVSLTGDNWGGLPSAHGIGNISGLGSGNLGRGAGDNNFGLPSGSYGRSNSTGT
IGEPFSAAGNTYDVNNADTYGSSSVYGGTVWRFTSSEVDMHSFGHDIGNVGPTIK*

Other information
Ka divergence:-0.340115KaKs divergence:-0.230683
GC content 1 (%):49GC content 2 (%):52GC content divergence:0.03
Length 1 (bp):1410Length 2 (bp):1248Length divergence:-0.061
MFE 1 (kcal):-514.01MFE 2 (kcal):-472.8MFE divergence-0.042