Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G163200-GRMZM2G379005
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279363 (LOC100279363), mRNA
Function (paralog2):hypothetical protein LOC100280196

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.74114977490771
Log2 mRNA fold difference:0.41474842339646
Log2 TE fold difference:0.33509862531537
Sequences
Protein sequence

MAGGGFVEDMMREQSLLEATCGDLFDHIDDLLDFPNEDSAAAVLLLDAPAPGSPLSARII
DVGRAGNALAPPAAPAQHDASASAFFAAAGNDVFDTKDVVGAHIGSCDDIDMDMAQLEWL
SGLFDDASIPHEPVFPGATAGGAAPIMKSSALAAGALLPQDKMEDALLFRSSSPISVLEH
GSGGSGSASATGSASSSSSSASSSSESFSGSGSGSGGGHVWSAPVSPRPAPPPALVIPAR
ARSKRSRSSAFTGAAARAGAETPTILVPTPMYSSGSAHSDPESIAESSPHPAPPMKKKKK
AKKPVVPAPAASSDDNDGDADYEEGGEQTEPQGGAVRRCTHCQIEKTPQWRAGPLGPKTL
CNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHKRVVEMRQKAVRSGDPSCDLLHFIRR
RD*

MMREQSLLEATCGDLFDHIDDLLDFPKEDSAADVLLLDAPAPGSPLSSARIIDVGRAGSA
PAPPALAPSLPAQQDTTAFFAAAGPDVFDPRDVGAHLGSCDDIDMDMDMAQLEWLSGLFD
DASIPHEPAFPGAAPIIKSSALAAGALLPPDKMEDALLFRSSSPISVLEHGSFNNANGGG
GGCSASSESSSASSSSESFSGSGSGSGEGHAWSAPVSPPPVLVIPARARSKRSRPSAFTR
AGAEAPTILVPTPMYSSGPSHSDPESIAESSPHPAPPMKKKKKAKKPPAPPAPASSDDND
GDADYEEGGERAEPQGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEY
RPAASPTFVPSIHSNSHKKVVEMRQKAVRSGDPSCDLLQFIRRRD*

Other information
Ka divergence:-0.360746KaKs divergence:-0.380192
GC content 1 (%):70GC content 2 (%):72GC content divergence:0.014
Length 1 (bp):1269Length 2 (bp):1218Length divergence:-0.021
MFE 1 (kcal):-659.1MFE 2 (kcal):-630.3MFE divergence-0.022