Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G164405-GRMZM5G894619
Species:maize
Duplication type:WGD
Function (paralog1):Acc synthase
Function (paralog2):1-aminocyclopropane-1-carboxylate synthase7

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.38137751516576
Log2 mRNA fold difference:0.36915835444536
Log2 TE fold difference:-0.91940170097562
Sequences
Protein sequence

MAGGSSAEQLLSRIASGDGHGENSSYFDGWKAYDMDPFDLRHNRDGVIQMGLAENQLSLD
LIEQWSMEHPEASICTAQGASQFRRIANFQDYHGLPEFREAMAKFMGQVRAGKVTFDPDR
VVMCGGATGAQDTLAFCLADPGDAYLVPTPYYPAFDRDCCWRSGVKLLPIECHSSNNFTL
TREALVSAYDGARRQGVRVKGVLITNPSNPLGTTMDRATLAMLARFATEHRVHLICDEIY
AGSVFAKPDFVSIAEVIERDVPGCNRDLIHIAYSLSKDFGLPGFRVGIVYSYNDDVVACA
RKMSSFGLVSSQTQHFLAKMLSDAEFMARFLAESARRLAARHDRFVAGLREVGIACLPGN
AGLFSWMDLRGMLRDKTHDAELELWRVIVHKVKLNVSPGTSFHCNEPGWFRVCHANMDDE
TMEVALDRIRRFVRQHQHKAKAERWAATRPMRLSLPRRGGATASHLPISSPMALLSPQSP
MVHAS*

MAGSSAEQLLSRIAAGDGHGENSSYFDGWKAYDMNPFDLRHNRDGVIQMGLAENQLSLDL
IEQWSVDHPEASICTAQGAPQFRRIANFQDYHGLPEFREAMAKFMGQVRGGKVTFDPDRV
VMCGGATGAQDTLAFCLADPGDAYLVPTPYYPAFDRDCCWRSGVKLLPIECHSSNNFTLT
REALVSAYDGARRQGVRVRGILITNPSNPLGTTMDRGTLAMLAAFATERRVHLICDEIYA
GSVFAKPGFVSIAEVIERGDAPGCNRDLVHIAYSLSKDFGLPGFRVGIVYSYNDDVVACA
RKMSSFGLVSSQTQHFLAMMLADAEFMARFLAESARRLAARHDRFVAGLREVGIACLPGN
AGLFSWMDLRGMLREKTHDAELELWRVIVHRVKLNVSPGTSFHCNEPGWFRVCYANMDDD
TMEVALDRIRRFVRQHQHSKAKAERWAATRPLRLSLPRRGATTASHLAISSPLALLSPQS
PMVHAS*

Other information
Ka divergence:0.175858KaKs divergence:-0.0471698
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):1458Length 2 (bp):1461Length divergence:0.001
MFE 1 (kcal):-680.42MFE 2 (kcal):-679.9MFE divergence0