Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G165063-GRMZM2G368047
Species:maize
Duplication type:WGD
Function (paralog1):inhibitor of apoptosis-like protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.12586402335515
Log2 mRNA fold difference:-3.7117135585488
Log2 TE fold difference:3.8667681552628
Sequences
Protein sequence

MAVQGRHLSHDLAAQAAGGYLFLDEYAGCAPAAAPAPARIGDATTALSDFPRVEVAWCNY
DGFLPRKRPRLETAAPAAGGGLSEDQRAGLPPAGTERLLPLPVAVAPFVNARSRRAVAAS
GTASTSGRVASGATVAASRGLLSSWTHRHGVEIDALVRLEAERMRAALEEARRRHARALL
AAVGRAASGRLRASETDLERALRRGAELEEKARQAGAECQAWMAVARRHEAAAAGLRATL
DQLLQSPYGAGGGREEGGEAEDAESCCFEDGGASCASRSKLACRSCGAGEASVLLLPCRH
LCLCRACEAGVDACPVCAAAKNGSLHVLVS*

MAVQARHFSHDLAPAAGGSLFLDEYAGCVPAPARIGDDTTVLSDFPRSELAWCNYGFLPR
KRPRLEAAAPAAGGDLLQDQRVGMPPAGTERLLPVPPLVDARSRAVGSGAATSTSGRVVA
VGAATVVSRDIPSSWTHHHGMEIDALVRLEAERMRAALQEARRRHGRALLAAVGRAASGR
LRASETGLERALHRNAELEEKARQAGAECQAWVGVARSHEAVAAGLRATLDQLRPRGAAV
CVCEAEAEDARSCCFGEAPAAHANGASMPKLACKSCGSGGACVLLLPCRHLCLCRVCDEA
GVDACPVCATTRNGSLHVLFS*

Other information
Ka divergence:-0.357106KaKs divergence:-0.104939
GC content 1 (%):76GC content 2 (%):74GC content divergence:-0.013
Length 1 (bp):993Length 2 (bp):966Length divergence:-0.014
MFE 1 (kcal):-603.1MFE 2 (kcal):-568MFE divergence-0.03