Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G166355-GRMZM2G174202
Species:maize
Duplication type:WGD
Function (paralog1):mRNA 3-UTR binding protein
Function (paralog2):LOC100282356

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.63690508661749
Log2 mRNA fold difference:-0.55981571375574
Log2 TE fold difference:-0.078669450473892
Sequences
Protein sequence

MNGAGGSHHQQQQRLRQQQQQALLMQQALQQQQQQQYQSGVLAAAAAAAMTQMEPVSNGN
LPPGFDPSTCRSVYVGNVNPNVTESLLIEVFQSAGLVERCKLIRKEKSSFGFVDYYDRRS
AALAIMTLHGRHVYGQAIKVNWAYASTQREDTSGHFHIFVGDLSSEVNDATLYACFSAYP
SCSDARVMWDNKTGRSRGYGFVSFRNQQEAETAITEMTGKWLGSRQIRCNWATKNNSEEK
PETDNHNAVVLTNGSSNNSATDASQDAGSKEPPQNNPDCTTVYVGNLGHEVNRDELHRHF
YNLGVGAIEEVRVQQDKGFGFVRYSTHGEAALAIQMSNGSVVRGKPIKCSWGVKPTPPGT
GSKPLPPPAATYQPAVAMPGVPQGFTTAELLAYQRQLALSQAAAGQQHAGLAGQVSAAGL
LAAAGSQALYDGYPNQSSAQQLMYYN*

MNGTGGSHHQQQHRLRQQQQQQALLMQQALQQQQQQHQYQSGVLAAAAAAAMTQMEPISN
GNLPPGFDPSTCRSVYVGNVNPNVTESLLIEVFQSAGLVERCKLIRKEKSSFGFVDYYDR
RSAALAIMTLHGRHIYGQAIKVNWAYASTQREDTSGHFHIFVGDLSSEVNDATLYACFSA
YPSCSDARVMWDNKTGRSRGYGFVSFRNQQEAETAITEMTGKWLGSRQIRCNWATKTNSE
EKPETDNHNAVVLTNGSSTNSATDASQDAGSKENPENNPDCTTVYVGNLGHEVNRDELHR
HFYNLGVGAIEEIRVQQDKGFGFVRYSTHGEAALAIQMANGLVVRGKSIKCSWGNKPTPP
GTTSKPLPPPVASYQPAVAMSGVPQGFTAAELLAYQRQLALSQAAAGQIAGQHGLAGQVS
AGLLAAAGSQALYDGYPNQSSAQQLMYYN*

Other information
Ka divergence:-0.407349KaKs divergence:-0.166474
GC content 1 (%):53GC content 2 (%):50GC content divergence:-0.029
Length 1 (bp):1341Length 2 (bp):1350Length divergence:0.003
MFE 1 (kcal):-484.04MFE 2 (kcal):-471.12MFE divergence-0.014