Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G166507-GRMZM2G429169
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.59564940900869
Log2 mRNA fold difference:1.1073594264194
Log2 TE fold difference:-0.50103500526279
Sequences
Protein sequence

MECNRDEAARAKVLAERKMLDKDFVGAKKLIIKVQQLLKEVEDIDIPKMLTVCDVHCAAG
AKVNTEIDWYGILQVPVNADDALIKKQYRKLALLLHPDKNKFGGAEAAFKLVGEANITLT
DPSKRYVHDMKRNTFRSVTARPNRQPPKRPAPARSSSTPVNLYNMHQQHQRQASNPTGTQ
TTFWTICPACGMRYQYYLSILKKALRCQNCLKPFIAHDLKDQAIPSGANQRSAGVWKNAG
TPQNSAGPQSNVTGQKGWSATSGVHVNTGSHHANVNTKRKTDGNAGGLKNKMKSAQATRK
PSKASSTAGLKRGRRAVFESSESSISETDSDGEVEIPKHGPAENSAGPGQQTRRSSRQKQ
EVKYNEDSDDDNDDVEDDDNTVEDDFVDSPALKRLRKGGMFHGDHSTKTAKLNEDTAGHN
SVNSWGNIKDKKNGGMPCEEKTSNGVEQMKRETMHVGENSDGKEELFHSVSNNGLGLNDD
DASDDNKFTFPDPEFFDFDKLRDASQFRANQVWAVYDDQGCMPRFYARITRVKMVPKFML
QFVWLEFNPANKAEEAWSYRGLPVACGHFTHGLSETTSETGMFSRIISLERSKTKNFYEI
YPRKGEVWALFKGWDIGWSSDAGIHKKMNHRYEVVQVLSDLTTSTSIIVMPLVKLKGYVS
LFVQSGEAAPYVIPQVDTLRFSHCVPHYLTSGTEKEGIPEGSLELDPAALPSNLEEAFPS
ANPECSSARSQESDSKNAGLSSGNRKGSMNVGQGQHKIAANGRVCTKTTKVENIKHNIDL
SEVTDVVDDSICQTEYVCADSEFYDFSVRRSLQRFSPGQIWALYSDIDKFPNYYAFIQKV
DLKNDKVQVRWLDVCPQGEVEKRLSQDRTIGIGTFRVGYIHDMMTYTGTDAFSHLVEARP
TGRKGEYEILPRLGEIWAVYKNWSAGWTAQDFEKCEYELVEIFGYTDSSIQVQLVRKVDG
YKMVFMSYRAGGVKTIRRDEYPKFSHQIPCFHLTHEKGGKLRGYLELDPLSLPEEFLC*

MKSAQSTRKPSKASSSAGLKRGRRAAFESSESSISETSSDSEEEILKHGPSENRAGPGQQ
TRRSSRQKQEVKYNEDSDDDNYDAEDGNTVEDDFFGSPALKRLRKGGLFHGDHSTKTAKL
NEDTTGHNGVSSCSNIKGKKNGGLPCEEKTSNCVEQMKREPMHVGENSDGKEELFHSIRN
NGLGLNDDDASDDNKFTFPDPEFFDFDKLRDASQFRANQVWAVYDDQGCMPRFYARITKV
KMVPKFMLNFMWLEFNPANKAEEAWSYRGLPVACGHFTHGQSETTSEIGMFSQIISLERS
KTNNFYEIYPRKGEVWALFKGWDIGWSSDAGNHKKMNHRYEVVQVLSDLITSTSIIVMPL
VKLKGYVSLFVQSGEAAPYVIPQGDTLRFSHCVPHYLMSGTEKEGIPEGSLELDPAALPS
NLEEAFPSANPECSSVRSKEHNSKHAGLSSEDCKETMNVGQRQQTKSVNAGIATKTPNEE
KIKHNTHLPEVTDVDDDNICQTEYVCAESEFYDFSRIRFLQKFSSGQIWALYSDIDKFPN
YYAFIQKVDLKNGTVQVRWLDVCPRGEVEKRLSQEERTIGIGTFRLGYIFDMMTYTGTDP
FSHPVKARATGRKGEYEILPRHGEIWAVYKNWEAVWTAQDFEKCEYELVEILGHTDSSIQ
VQLLRKVDGYKMVFMSYRAEGSVMTIRNDEYPKFSHQIPCFRLTHEKGGKLRGYLELDPL
SVPEEFLD*

Other information
Ka divergence:0.128817KaKs divergence:0.32283
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):3057Length 2 (bp):2187Length divergence:-0.166
MFE 1 (kcal):-888.44MFE 2 (kcal):-631.44MFE divergence-0.169