Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G166658-GRMZM2G316136
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):CBL-interacting serine/threonine-protein kinase 15

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-5.1887503273945
Log2 mRNA fold difference:-3.9815514024459
Log2 TE fold difference:-1.1671276364477
Sequences
Protein sequence

MAEHKGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQR
EISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLI
CAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALAECHRQDGLLHTTCGTPAYVA
PEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWFSTDV
RRLLQRILDPNPSRRISMEKIMENPWFRKGLGAKLLRYDLQNKNAPHVDKNADFDSLSAN
ITTESKQHEEKKPINMNAFDIISLSTGLDLSGLFEESNKKRESKFTSTNTSSTIISKIED
IAKNLRLNLTKKDGGLLKMEASKPGRKGVMGIDAEVFEVSPNFHLVEIKKTNGDTLEYQK
VLNQEMRPALKEIVWAWQGEQSKQKQEQQSC*

MHACKMMAGHNKRNIILMHKYEMGRLLGQGTFAKVYHARNTRTSVSVAIKVIDKGKVVKV
GLVDQIKREISAMKLVRHPNVVQLNEVIATKTKIYFVLEYVKGGELLAKVKRGRLKEDVA
RKYFQQLICALDFCHSRGVYHRDLKLENLLLDENSDLKVSDFGLSALAECRRQDGLLHTT
CGTPAYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFYDKNLIDLYKKIDSADFRC
PTWFSTHVRRLLLRILDPTPGTRISIEKIMENPWFRQGLDHANLLLRYNLKTNDAPQVDT
DKNEDFDPPSTNITTDSKQEDEKKPANMNAFDIISHLSSGLDLSGLFQESDKKTESKFTS
TNTSSAIISKIEDIAKDLRLKLTKKDGGLLKMEASKPGRKGVMRIDAEIFEVSPNFHLVE
IKKTNGDTLEYQKVMHQEMRPALKDIVWAWQGEQLKQQQEQQQ*

Other information
Ka divergence:0.37313KaKs divergence:0.0816916
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1356Length 2 (bp):1392Length divergence:0.013
MFE 1 (kcal):-407.5MFE 2 (kcal):-417.2MFE divergence0.012