Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G169539-GRMZM2G470075
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100272673
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.37795749796255
Log2 mRNA fold difference:-0.49255058470474
Log2 TE fold difference:0.95862245459612
Sequences
Protein sequence

MMGRTGDGRRRDVDGRLEALLSGAGGEEPWLRRVALATALELRLLAPLAAPAVVVYMLII
VMSSTTQIVCGQLGNVQLAAASLGNNGIQVFAYGIMLGMGSAVETLCGQAYGAEKYEMLG
VYLQRSTVLLTATGVPLAAVYALSEPLLLLLGQSPEIAGAAAEFAYGLVPQIFAYAANFP
IQKFLQAQSIVAPSAYILAASFALHVPLSWLAVYGLGLGLLGASLTLSLTWWVLVLGQFA
YIVWSPRCRATWTGFTWAAFADLPGFAGLSAASAVMLALEVWYFQVLILLAGMLPDPQIA
LDSLTVCTSIQSWVFMISVGFNAAASVRVGNELGAGNPRSAAFSAWVVTALSAFVSGIAG
LVTFLLRDKLSYIFTGGEAVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQAMVAYI
NVECYYFIGVPLGVLLGFKFGFGIKGLWGGMIGGTLIQTLALIWITLRTDWNKEVEEARK
RLDKWDDTRQPLVASKE*

MDSTTTTAPLLQPAAAASSKEEPAPASPHGAGSWELEAVLADASSPVLRRAWEGARLELP
LLLRVALPAVGVYVINFVMSMSTQIFCGQLGNLELAAASLGNTGIQSLAYGLMLGMGSAV
ETLCGQAYGAHKHGMLGVYLQRSTVLLMATAVPLTVVYAFSARILVLLGESERISRAAAV
FVYGLIPQIFAYAANFPIQKFLQAQSIVAPSAYISVATLGLHLGLSWLAVYRLGLGLLGG
SLVLSFSWFVIVAAQFAYIVTSPRCRDTWTGFTMQAFSGLGTFFKLSAASAVMLCLETWY
YQIIVLIAGLLKNPEISLDSLSICMTVNAWGVYDIRGLQRRGERAGRERARRGQPEGGVV
LGAGGDVAVVRRVGGVRRRRALPPRPAELPVHGRRGRGSRRVRPLPAPRPHARPQRRAAS
ALRRRRGLRVAGLRGVRERRLLLRRRRAARRLPRLLPRPRRQGHLERHGHRGNHDADAHP
ALGHLQNRLDQGGGERQGEAGQVGRQEAAPPSLEED*

www.000webhost.com

Other information
Ka divergence:0.342658KaKs divergence:-0.908163
GC content 1 (%):66GC content 2 (%):68GC content divergence:0.015
Length 1 (bp):1494Length 2 (bp):1551Length divergence:0.019
MFE 1 (kcal):-751.5MFE 2 (kcal):-779.1MFE divergence0.018