Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G170457-GRMZM2G318346
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384355
Function (paralog2):hypothetical protein LOC100383274

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5628679521824
Log2 mRNA fold difference:-1.3628670761902
Log2 TE fold difference:-0.24066050025034
Sequences
Protein sequence

MSSMMNALANWLANPRRNPLARLHMHAVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPR
EVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLGDMLALVKKESAERQSLGALPL
YQRTLP*

MSSMMNALSNWLVNPRRNPLARLHMHTVSSRLRKYGLRYDDLYDPYFDLDIKEALGRLPR
EVVDARIQRLKRAMDLSMKHQYLPEDLQAQQVPFRGYLSDMLALVRIFLLHSIGISYAFE
LESLHSPFFNACKGPNLHDMNYA*

Other information
Ka divergence:0.767114KaKs divergence:-0.999632
GC content 1 (%):60GC content 2 (%):54GC content divergence:-0.053
Length 1 (bp):381Length 2 (bp):432Length divergence:0.063
MFE 1 (kcal):-146.2MFE 2 (kcal):-146.76MFE divergence0.002