Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G172065-GRMZM2G416216
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279324
Function (paralog2):hypothetical protein LOC100384078

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1563959655834
Log2 mRNA fold difference:1.2245605507652
Log2 TE fold difference:-2.3677865905995
Sequences
Protein sequence

MAAAGPRRAGARFLLARGIGSSVAHVHSLGRGGGGVTMPRALLADSAPASAPAMTGRAPP
AASSSASAAASRITPAVLFVTVVLAVVLLVSGLLHVLRRLFLKSHHAGAGAGERHLQHLF
FPAHDDGAGAGSGSGSGAGGGGGLGQDAIDALPEFAYGELSGGGAAAAAPASRKGKEKAA
GPFDCAVCLSEFADHDRLRLLPLCGHAFHVACIDVWLRSSATCPLCRTKLSARHLVAAAA
DAPAPASVAPDVGEQRPQRDHAPEAAEAASSSVVLPVRLGRFKNADAESAEAESSNGGAT
SRVERRRCYSMGSYQYVVADEHLLVSVHLRHGTSAAVAASSGVDGDDRQQHQGKKVFARG
DSFSVSKIWQWRGSKRLPGALCADDGLPWAPAKDDRASACTRQRGDT*

MASGVSEPETNRQPSCTWHGMASLSRPFMVVVGIVDQSMAVAGASPSPVHDPASAQPPPT
LTCCSVFNSPPRFPCEEPNNLPSARDVTCLRRASWYFGSIAPNPSKASLDCSRSQVDLFG
SVPPSVPLAMASLSRFNLASDCSTSPDPSPHRLHSCCCRPGRRTADDCCGSTGAGPGSES
ERDSTRKTKMPAAGLRRAGGRFPLARDVGSSGANERSSSVRRGFGGGVAMPRALLEDSAP
AVDAPATTGREPPPPASSAASRVTPAVLFVTVVLAVVLLVSGLLHVLRRLFLKSRHASAG
AGERQLLQHEDAGGGLGQAAIDALPEFAYGELSGGGAAASSKGKGKGKEKAARPFDCAVC
LCEFDDRDRLRLLPPCGHAFHVACIDVWLRSSATCPLCRTRLSAPSSVGPDVEEQKLQQD
HQPPDDESGVVLPLPVRLGRFKNADAESSTGATSRIDGRRRCYSMGSYQYVLADGDHLLV
SVHLRHGNARGGSGAVCGPSAAAPSGSDPRQGKKVFARGDSFSVSKIWQWRGSKRLPGGL
CADDDGLPWAPAAKDRTTNTRRQHSDT*

Other information
Ka divergence:0.184173KaKs divergence:-0.0515723
GC content 1 (%):75GC content 2 (%):69GC content divergence:-0.042
Length 1 (bp):1224Length 2 (bp):1704Length divergence:0.164
MFE 1 (kcal):-685.9MFE 2 (kcal):-838.7MFE divergence0.1