Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G173315-GRMZM2G337048
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383459 (LOC100383459), mRNA
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.15640177568917
Log2 mRNA fold difference:-0.8079588532257
Log2 TE fold difference:0.9695629674706
Sequences
Protein sequence

MGQEEAVAANGTGTGVGRGRPHAVVMPYPLQGHVIPAVHLALRLAERGFAVTFINTESVH
HQIGAGGDIFAGVRARGGGTTTEELDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAH
VEDLLRRRVVVDPATTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTK
HGHFKCKDPRKDTITYIPGVASIEPSELMSYLQDTDTTSVVHRIIFRAFDEARRADYVLC
NTVEELEPSTIAALRADRPFYAVGPIFPAGFARSAVATSMWPESDDCSRWLGAQPPGSVL
YISFGSYAHVTKQELREIAGGVLASGARFLWVMRPDIVSSDDPRPLPEGFAEAAAAAGRG
LVVQWCCQVEVLSHPAVAAFLTHCGWNSVLESVWAGVPMLCFPLLTDQLTNRRLVVREWG
AGVSIGDRGAVHADEVRARIQGIMAGEHGLKLRDQVRKLRATLEAAVAPGGSSRRNFDDF
VDELKRKLKDAS*

MAQGAAGVVDTRRHGGKPHAVVVAYPLQGHVIPVVHLALRLAARGFAVTFVSTEAVHDQT
ARALGVDPDGYDPFAAARARAQEEGPPPPPLGDVSYALVSDGLPVGFDRSLNHDDFMGAL
FHALPAHVEQLLRRVVVEPRATFLVADTFFVWPATLARRLGIAYVSFWTEPALIFNLYYH
IDLLTQNGHFRCNEPRKDTITYIPGVAAIEPSELMSYLQETDTTSIVHRIIFKAFDEARG
ADYVLCNTVEELEPSTIAALRAYRPFYAVGPILPAGFARSAVATSMWAESDCSRWLDAQP
VGSVLYISFGSYAHVTKQELREIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFAEAAA
GRGLVVQWCCQVEVLSHAAVGAFLTHCGWNSVLESVWAGVPMLCFPLLTDQLTNRRLVAR
EWRAGVSVGDRGAVRADEVRARIEAVMGGEDGLKLREQVKKLRGTLEAAVASGGSSRHNF
DEFVEELKRRCGGR*

Other information
Ka divergence:0.187595KaKs divergence:-0.402597
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1479Length 2 (bp):1485Length divergence:0.002
MFE 1 (kcal):-762.41MFE 2 (kcal):-772.37MFE divergence0.006