Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G173989-GRMZM5G802854
Species:maize
Duplication type:TD
Function (paralog1):Exosome complex exonuclease RRP40
Function (paralog2):exosome complex exonuclease RRP40

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.049340073831005
Log2 mRNA fold difference:-1.5329541198154
Log2 TE fold difference:1.614903022763
Sequences
Protein sequence

MELRRPASSPLVDNYVVPGDVVLDLSEMNNQTIKLGAGLRQECDTIQATSAGKLRQLKPN
KYWIENSQKRYIPSVEDTVLGIVVDTKPDNFLVDIKGPNLAFLPVLSFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDATGKAAEFGQLKDGYMFDTSTGMSRMLLSSPTCPVL
EVLGKKLSFEIAVGLNGRVWVNAPAASTVILVSNAIMRSESLSGIKQRAMVENLLERLS*

MELRRPAPSPLVDNYVVPGDVVLDLSEMNNQTIKLGAGLRQECDTIEATSAGKLRQLKPN
KYCIENSQKRYKPSVEDTVLGIVVDTKPDNFLVDIKGPNLAFLPVLSFEGGTRRNIPKFK
IGTLIYARVVKANSIMNPELSCMDATGKAAKFGQLKDGYMFDTSTGMSRMLLSSPTCPVL
EVLGKKLSFEIAVGLNGRVWVNAPAASTVILVSNAIMRSESLSGIKQRAMVENLLERLS*

Other information
Ka divergence:0.67427KaKs divergence:0.897747
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):720Length 2 (bp):720Length divergence:0
MFE 1 (kcal):-221.2MFE 2 (kcal):-226.4MFE divergence0.012