Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G174615-GRMZM2G341309
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100278628
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.8946497539574
Log2 mRNA fold difference:-3.526701117052
Log2 TE fold difference:-0.38323915623538
Sequences
Protein sequence

MAQPRVHPNAAAAAGDLEMGGNGGVFPPLPVRGQPASVNQQQLGGGPHTWVGNDANTLLV
VATLITTLTYQLGTSIPGGYWQQDTTAASRDGKEQVTYRAGDPIMRDLHRPRYWVFMGAS
WVGFASSMMMTLSLLVRMPVDSRHVRWSFVVAYSSLVLTFVVSQPKTHLSLDLLIWAAVL
VFLWIIVSLHPDRRARVIQELCCGGRDT*

MAIDAGKKLLAEGICKTLWGWLVLKTDLSLEFQAWTPNNKIVSPLSRLASFRQTENRLSV
DSRALMYPRVNSDALPALGSLEMGHAAHAVAYPPLPPVEVIPVTVIQQRHGERALDPDRS
SCEDHDPSALVVAATLITTLAFLLGSSVPGGYWPQDTPSRDGGKLYRAGDPIMRDLHRPR
YWVFRVASWFGVASSMVLTLSLLLRMAATSRHVRWSFVVAYASLLLTFAASQTKTHLSLD
IILCLLVLFVSWLITSVREENRACIMKVLCCSSRDN*

Other information
Ka divergence:0.458387KaKs divergence:-0.618381
GC content 1 (%):69GC content 2 (%):64GC content divergence:-0.038
Length 1 (bp):627Length 2 (bp):831Length divergence:0.14
MFE 1 (kcal):-302.2MFE 2 (kcal):-374.5MFE divergence0.107