Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G174917-GRMZM2G421033
Species:maize
Duplication type:WGD
Function (paralog1):dehydration responsive element binding protein
Function (paralog2):dehydration responsive element binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1975499445828
Log2 mRNA fold difference:-1.0303986828505
Log2 TE fold difference:-0.19938210760182
Sequences
Protein sequence

MQGEYRSSSEESAAAAAAAAMAPLAAAAAAAVKMEAEQAAMASAAAPQLGSAHQHQHQHQ
QMQPRRQYRGVRMRKWGKWVAEIREPHKRTRIWLGSYATAVAAARAYDTAVFYLRGRSAR
LNFPDEIPSLAPSEGEGDGDGGEPARDPADGGGGGTLSAASIRKKAIEVGSRVDALQTGM
MVPPPHHRERQRHHHHHHHHLPQLRMHAAAAEAAAAEHRQEVKQSPQRPAWSGRVKNPDL
NRAPSPESSDAE*

MMQGEYRSSIEESAAAAVAAAAAMAPLAAAAVKMEAEQAAMAAPQLGAAHQQTQPRRQYR
GVRMRKWGKWVAEIREPHKRTRIWLGSYATAVAAARAYDTAVFYLRGRSARLNFPEEIPS
FGLADGVDVGEHARDPAAAAAGGGGGCTLSAASIRKKAIEVGSRVDALQTGMVVPPPHHR
ERHRHHNHLPQLRVHAEEQQEEEEQKPQRPAWSGRVKNPDLNRAPSPESSDAE*

Other information
Ka divergence:0.496229KaKs divergence:0.432262
GC content 1 (%):75GC content 2 (%):73GC content divergence:-0.014
Length 1 (bp):759Length 2 (bp):702Length divergence:-0.039
MFE 1 (kcal):-450MFE 2 (kcal):-400.5MFE divergence-0.058