Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G174990-GRMZM2G355610
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Phosphatidylinositol transfer protein Fragment

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4672258559329
Log2 mRNA fold difference:-1.818792346549
Log2 TE fold difference:0.34077341874372
Sequences
Protein sequence

MNRVQRHDRNLSFSHHPPGVCPHAHPLKSRAAAALLLLLPGQNHQLPKSKLKQGRIPVPA
DGMSGPLDRFARPCFEGFVHNDERKESRSDADNSEGDKKTKIGSFKKKAINAGNKFRHSL
RRRSKKKTERGDSIKDIRDVKELQDVETFRQCLIDEDLLPPQHDDYHMMLRFLKARKFEV
EKAKSMWSDMINWRKEFGVDKIEEFDYTELDEVTEYYPQFYHGVDKEGRPVYIELVGKVD
ANKLIQVTTLDRYVKYHVKEFEKCFQMKFPACTIAAKKHIDSSTTILDVQGVGFKNFSKS
ARELITRLQKIDSDNYPETLCRMYIINAGQGFKMLWSTIKSFLDPKTASKIHVLGNKYQH
KLLEIIDECELPEFLGGKCNCIEGCQRSDKGPWKDPNIIKRVLNDEANYGRQIVTISSID
GKIIRYARPDHPTRKGSDASAESGSEVEDVTSPTASRNLITHPILTPVHEESKLSPHGST
FVAHASIEENIPVVDKVVDDGWGTPRGSLQASSGSLPSRNTHGTFEGLRVQAVAWLTFLI
TALFATLCSVPSKMARRISSQSSKHDDYRGEYPQEEEEHKEEFRPPSPAPSYTEKDVLSS
MLRRLGELEGRVQVLETKPSEMPFEKEELLNAAVRRVDALEAELISTKKALYDALMRQDE
LLAYIDRQELIKFRKKKFCF*

MSAPLDRLARPCFEGFVHNDERKESRSDADNSEGDKKTKIGSFKKKAINAGNKFRHSLRR
RSKKKTERGDSIKDIRDIKELQDVETFRQCLIDEDLLPPQHDDYHMMLRFLKARKFDVEK
AKNMWSDMLKWRKEFGVDKIEEFEYAELDEVKKYYPQFYHGVDKEGRPVYIELIGKVDAN
KLVQVTTLDRYVKYHVKEFERCFQMRFPACSIAAKKHIDSSTSIFDVQGVGFKNFSKSAR
ELITRLQKIDNDNYPETLCQMYIINAGQGFKMLWSTIKSFLDPKTASKIHVLGNKYQHKL
LEIIDECELPEFLGGKCKCIEGCERSDKGPWKDPNIIKRVLNGEANYGRQIVTISSTDGR
IVSYAWPVHPNRKGSDASAESGSEVEDVTSPTASRNLITHPILTPVHEESKLSAHGSSSV
VHASIGENIPVVDKIVDDGWGSPRSSPQAASSGSLSLRNLHGTFEGLRAQTITWLTFLMM
TLFAMLCSVPSKMARRISNQSGKHDDYHVEYPQEQECKEEFRPPSPAPSYTENDVISSML
RRLGELEDKVQVLETKPSEMPFEKEELLNAAVRRVDALEAELISTKKALYDALMRQDELL
AYIDRQELIKFRKKKFCF*

Other information
Ka divergence:-0.282147KaKs divergence:-0.421726
GC content 1 (%):47GC content 2 (%):43GC content divergence:-0.044
Length 1 (bp):2043Length 2 (bp):1857Length divergence:-0.048
MFE 1 (kcal):-641.34MFE 2 (kcal):-543.29MFE divergence-0.083