Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G179069-GRMZM5G880268
Species:maize
Duplication type:WGD
Function (paralog1):Dof3 gene Fragment
Function (paralog2):hypothetical protein LOC100272994 (LOC100272994), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.99584919081083
Log2 mRNA fold difference:-1.8458295682632
Log2 TE fold difference:0.86261123412913
Sequences
Protein sequence

MIFPPAFLQDSSSWNDNQHQQQQHHHQQQGHGHLQIAVSGSGDANHELLQQPIMGGALPD
GGGGGGGGGQVGGPAKPMSMAERARLARIPLPEPGLKCPRCDSTNTKFCYFNNYSLTQPR
HFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPKQQQQQHAAAGTGAATGAMQQPPAGS
MASSAAACTATTTMTTNALHAGPGGGMLPMLPPLLRLADFDAMSLGSSFSGISSMGKPGS
IGAACYPHSVGGLEQWRVQQMQSFPFLHAMDQGPLGPPLAMAMAAPGGMFQLGLDTTSDN
SRGGGGGGEDGSSAGEALHMMQATKRESYPAAPRAMYGDQQHNHLAAAGGYTSYSTNAAA
GNHLL*

MIFPPAFLHDSSSWNDNQHHQQHQVAAGGAGDASHELLQPSIMGGALPDGGGDGGGGQVI
GGPAKPMPMAERARLARIPLPEPGLKCPRCDSANTKFCYFNNYSLSQPRHFCRACRRYWT
RGGALRNVPVGGGYRRHAKRAKPKQQPAGAGAGTGIAATTAALQQAPASSAAACTATTTA
TTTPLPGGGSGGGLSMLPPLFRLADFDAMSLGSSGFSGISSMTGKPSSVDAYAHSVSGHA
PAPGGGLLEQWRVQQMQSFPFLHAMDQGLLGPPLAMAMAPAPGSGMFQLGLVDTTTSDNG
RGGGGEDGWSSTRDQPLHVMQAAAATKKRESYPAPAPRGVYGYGDHHHHHLAAAADGGGY
ASYSTNAAAGNNHLL*

Other information
Ka divergence:-0.00271824KaKs divergence:0.268571
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):1098Length 2 (bp):1128Length divergence:0.013
MFE 1 (kcal):-533.43MFE 2 (kcal):-550.45MFE divergence0.016