Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G179733-GRMZM2G314707
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194079
Function (paralog2):prenyltransferase/ zinc ion binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9780405971376
Log2 mRNA fold difference:-1.3889469818492
Log2 TE fold difference:3.3206470864195
Sequences
Protein sequence

MDVPAVADPGTERGEGALIQCPYCDSEAMHKLAQILLPGLAAVCVDGTTGDPFRSPSAVA
VDLRKEMVDYITQRSDSFIADALIESEANQDAPGAEVPDDPFETVSVFMDDFASTKRNII
GHVSGWLLTDSRDDKIDDFVQEMEATKFWPLERREAVAELLLKNVDLKTRFHCPEKYENE
ERLEDHKAQCSFRPVACANDGCRAKVSVRCVKDHDAACVYKLLQCEQGCDKRLLRRDMDR
HCVTVCPMRPMKCPFGCDSSFPDRDLERHCAEFLQPHLLMVLKAIHKKGRSEQDLKDLAQ
KLEKFDGDGKLAKALDARPLTNVVKDLEAKMKGGQSS*

MSPGPFFGCAVHFFVASFQIPRLQYPRKKKNVSVSSETITVAEIERQMYISSEKLENAAE
LLGTAPSRVQVPGLITKQAATARMELPVAEPGTERGEGPLIQCPYCDSEAMHKLAQILLP
GLAAVCVDGTTGDPFHSPSVVAVDLRREMVDYITQRSESFIADALIESEANQEGPDAAVP
DDPFEAVSVFMDDFGSTKRNIIGHVSGWLLSDSRDDKIDDLVQEMEATRFWPLERREAVA
ETLLKNVDLRTRFHCPEKYESEARLADHKQQCSFRPVACPNDGCRARVSVRCARDHDAAC
PYKPLQCEQGCEKRLLRRDMDRHCVTVCPMRPMKCPFGCDSSFPDRDLEKHCAQFLRPHL
IKVLKAIHKKARSEDELKDLALKLEKYDGDGKLAKALDARPLTNAVKDLEAKMKAEHSSR
RAVLH*

Other information
Ka divergence:0.192219KaKs divergence:-0.041728
GC content 1 (%):63GC content 2 (%):62GC content divergence:-0.008
Length 1 (bp):1014Length 2 (bp):1278Length divergence:0.115
MFE 1 (kcal):-414.3MFE 2 (kcal):-537.36MFE divergence0.129