Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G179777-GRMZM2G454474
Species:maize
Duplication type:WGD
Function (paralog1):triacylglycerol lipase
Function (paralog2):triacylglycerol lipase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.69649443192695
Log2 mRNA fold difference:1.2489572206616
Log2 TE fold difference:-0.78717071039191
Sequences
Protein sequence

MAMAQQASLPCSTATTWRELTNTSWRDDDYRRMVMAYLIEAVYLLELERQERRDAAAVAQ
QWWKPFHFRLAHELVDDRDGSVFGAVFERDHQGGRPGPGPSPSGAPSAVIAFRGTLLRAP
TIRRDVEDELRLLARNSLRGSARLARAAQALRATIDRFGSENVCVCGHSLGAGFARQVVR
TLVASSSSSPRQPRQQAAAFAAATLESHLFNAPYLSLPMGVRSVVRTADCLLKALRSGVA
TVGKWHGKALRNVAYASCVLGYTRLESTRKL*

MAQQASSPACPTTATTTTTWTELTNTSWRDDDYRRMVMAYLIEAVYLLELERQERRDAAA
VAQQWWEPFQFRLAHELVDDRDGSVFGAVFERDHQASPTPTPSGAPSAVVAFRGALLRAP
TIRRDVEDRLRLLARDSLRGSARLARAAQALSATVDRFGSENVCVCGHSLGAGFARQVVR
MLVASSPRQQQQQQQQAAAASLEYHLFNAPYLSLPMGVRGVLRTADCLLKALRSGVAKWR
GKALRNVAYANCILGYTRLESTRKL*

Other information
Ka divergence:0.302685KaKs divergence:0.42173
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):816Length 2 (bp):798Length divergence:-0.011
MFE 1 (kcal):-430.72MFE 2 (kcal):-399.54MFE divergence-0.038