Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G180920-GRMZM2G365298
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278506
Function (paralog2):hypothetical protein LOC100278841

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.8139680542592
Log2 mRNA fold difference:-2.4358394208763
Log2 TE fold difference:-0.35351622535219
Sequences
Protein sequence

MATILENIQKARFLPTRPLKDELPTFQGGGKSKEESHLMGLRKRLSSFSGKIQPISSASA
AEWAFRRSKSAPSLGAAFAAGGGSLRQWWQWGVGWLLSKKPGFAGDLEMNEEEVAALGRQ
SRGTWAHILFKMRSGVRRLVASAHSLPTTHKQQSLPSSSAAAAHSVQCKPAASFAYAQRQ
SFHHTGHAMAH*

MATILETIQKARLLPPRPLKDELPTFGGGGREESHLTGLRKRLSAFSGKIQPISSASAEW
AFRRRSRPAPSLSAGGGSLRQWWRRGVVGWLLSRKPGFAGDLEMNEDEGRHGGRGTWGWG
HVLYRVRSGVRRLVVSAHSLPTTQSQSLPPPAHCKPAALAHAQRLGFHHAGHAMAH*

Other information
Ka divergence:0.814131KaKs divergence:0.107808
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):576Length 2 (bp):531Length divergence:-0.041
MFE 1 (kcal):-288.3MFE 2 (kcal):-287.8MFE divergence-0.001