Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G180979-GRMZM5G845366
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381668

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.48521710307144
Log2 mRNA fold difference:1.2297955571201
Log2 TE fold difference:-0.7494656250463
Sequences
Protein sequence

MNGMPISASSAASVDSGAVAAGTPMKNATAADALAEMARHLTVDTEDTFAGLLELAADDD
AEGLRLALERAPPAAADEAGLWYGRRKVLEHRTPLMVAATYGSLAALRLLVSISYVDVNR
RSGTDGTTALHCAASGGSRTAVESVKLLLGAGADANTMDDAGRRPADVISVPPKMFDAKF
ALQDLLGFPKSEHGMLRVVTRSTNSISSPVSSPTAEDARSPSASVMMMTKFADLPRVATS
EKKEYPVDPSLPDIKNSIYASDEFRMYSFKIRPCSRAYSHDWTECPFVHPGENARRRDPR
KYHYSCVPCPDFRKGVCRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCNRRVCFFAHT
TDELRPLYVSTGSAVPSPRASATAAMEMAAAMGLMPGSPSSVSAVMSPFTPPMSPSGNGM
PPSLGWQQPNVPTLHLPGSSLQSSRLRTSLSARDMPADDYSMMRDLDSQLMNDLCYSRLS
SSTGNHSARTKSLNPSNLDDLFSAEMLSSPRYSNADQGAMFSPSHKAAILNQFQQQQQAL
LSPINTGVYSPKGVDNQQLPSHSSLLQASLGMPSPGRMSPRCVESGSPMSSHLAAALVQR
EKQQQTMRSLSSRDLGPSAARASALGSPLSSSWSKWGSPSGTPDWGINGEELGKLRRSSS
FELRSGGDDPDLSWVHTLVKESPPEKQVTTAESISSVGPSPLMPPGMNNGDGSGLSTQLD
GHDQAAVIGALLEQMQLDQQIGSLAT*

MYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKYHYSCVPCPDFRKGVCRRGDMCEY
AHGVFECWLHPAQYRTRLCKDGTSCNRRVCFFAHTTDELRPLYVSTGSAVPSPRASATAA
MEMAAAMGLMPGSPSSVSAVMSPFTPPMSPSGNGMPPSLGWQQPNVPTLHLPGSSLQSSR
LRTSLSARDMPADDYSLMPDFDSQLMNDLCYSRLGSSTGNHSARTKSLNPSNLDDLFSAE
LVSSPRYSNGDQGAMFSPSHKAAILNQFQQQQQALLSPINTGVYSPKAVDNKQLPSHPSL
LHASLGMPSPGRMSPRCVESGSPMNSHLAAALAQREKQQQTMRSLSSRDLGPSAARASAL
GSPLSTSWSKWGSPSGVPDWGVDGEELGKLRRSSSFELRSGGDDPDLSWVHTLVKESPPE
KQVTTSESINSVGPSPLMPPSMNNGGEGSGLNTQLDGRDQAAVLGALLEQMQLDQQIGSL
AT*

Other information
Ka divergence:0.320656KaKs divergence:0.520454
GC content 1 (%):57GC content 2 (%):54GC content divergence:-0.027
Length 1 (bp):2241Length 2 (bp):1449Length divergence:-0.215
MFE 1 (kcal):-887.69MFE 2 (kcal):-522.38MFE divergence-0.259