Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G180982-GRMZM2G300944
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273412
Function (paralog2):hypothetical protein LOC100273078

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.069290666857974
Log2 mRNA fold difference:-0.93286981586047
Log2 TE fold difference:0.88340783914049
Sequences
Protein sequence

MADSMVASFWGPVTSTTELCEENYAHSSYIAEFYNTISNVPCVLLALIGLVNAFCQGFEK
RFSVLHISNMILAIGSMIFHATLQLLLQQSDETPMVWEILLYMYVLYSPDWHYRSTMPTF
LFLYGAAFAVVHFFARFQVVFKLHYVGLCLLCIPRMYKYYIQTKDVGAKRLAKLWVLTLT
LGTLCWLVDRVFCKKLSHWYVNPQGHAWWHVLMGLNSYYANTFLMFCRAQQRGWEPRITH
LLGFLPYVKVQKPEKRE*

MADSMVASFWGPVTSTTELCEENYAHSSYIAEFYNTISNVPCVLLALIGLVNAFRQGFEK
RFSVLHISNMILAIGSMIFHATLQLVLQQSDETPMVWEILLYMYVLYSPDWHYRSTMPTF
LFLYGAAFAVVHFFARFQFVFKLHYIGLCFLCIPRMYKYYIQTKDVAAKRLAKLWVLTLT
LGTLCWLVDRIFCKKLSHWYVNPQGHAWWHVLMGLNSYYANTFLMFCRAQQRGWEARITY
LLGFLPYVKVQKPEKKRE*

Other information
Ka divergence:0.114098KaKs divergence:0.121212
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):774Length 2 (bp):777Length divergence:0.002
MFE 1 (kcal):-246.98MFE 2 (kcal):-227.03MFE divergence-0.042