Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G300692-GRMZM2G443785
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191914
Function (paralog2):hypothetical protein LOC100191794

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.47176867400239
Log2 mRNA fold difference:-0.12611668757299
Log2 TE fold difference:0.60692527226224
Sequences
Protein sequence

MLWVARLSGFLSAAMVMVVLSPSLQSFPPAEAIRSSQFDGSVRFPGQIAGGARGVAFRRA
PSFRNAADCGAGAGNGTAANVCDPSLVHTAITLDEEYLRGSVAAVHSVVQHARCPESVFF
HFLVSDPSLGDLVRAVFPQLRFKVYYFDPGRVRGLISTSVRQALEQPLNYARNYLADLLE
PCVRRVIYLDSDLVLVDDVAKLWRTDLGGRTVGAPEYCHANFTKYFTSRFWSDQRFAGTF
VGRRPCYFNTGVMVLDLERWRRAGYTQRIERWMEIQKSPPGRIYELGSLPPFLLVFAGHV
APIEHRWNQHGLGGDNVLGSCRDLHPGPVSLLHWSGSGKPWARLGAGRPCPLDALWAPFD
LYGPAGAGGEESR*

MLWVARLSGLLSAAMVVVVLSPSLQSFPPAEAIRSSQFDGSVRFPGQIAGGARGVAFRRA
PPFRNAADCGAGADNGTGANVCDPWLVHIAITLDNEYLRGSVAAVHSVVQHARCPESVFF
HFLVSDPGLGDLVRAVFPQLRFKVYYLDPGRVRGLISTSVRQALEQPLNYARNYLAELLE
PCVRRAIYLDSDLVVVDDVAKLWRTDLGGRTVGAPEYCHANFTKYFTGRFWSDQRFAGTF
AGRRPCYFNTGVMVVDLERWRQAGYTQRIERWMEVQKSAAGRIYELGSLPPFLLVFAGHV
APIEHRWNQHGLGGDNVLGSCRDLHPGPVSLLHWSGSGKPWARLGAGRPCPLDALWAPFD
LYDPGGGAEESPYKF*

Other information
Ka divergence:0.528419KaKs divergence:0.379953
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):1122Length 2 (bp):1128Length divergence:0.003
MFE 1 (kcal):-564.48MFE 2 (kcal):-595.39MFE divergence0.027