Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G302712-GRMZM2G326066
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193258
Function (paralog2):hypothetical protein LOC100193258

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.66272649159419
Log2 mRNA fold difference:0.29295492631294
Log2 TE fold difference:-0.98075340916969
Sequences
Protein sequence

MLVSLALSAPISSTSQTLPAAQQHHNHRPKMVKFLKPGKAVILLQGRFAGRKAVIVRVFE
EGTRDRPYGHCLVAGLAKYPKKVIRKDSAKKTAKKSRVKCFIKLVNFTHLMPTRYTLDVD
FKDVASGGPDALSTRDKKVEACKAAKARLEERFKTGKNRWFFTKLRF*

MVKFLKPGKAVILLQGRFAGRKAVIVRVFEEGTRDRPYGHCLVAGLAKYPKKVIRKDSAK
KTAKKSRVKCFIKLVNFTHLMPTRYTLDVDFKDVASGGPDALSTRDKKVEACKAAKARLE
ERFKTGKNRWFFTKLRF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):504Length 2 (bp):414Length divergence:-0.098
MFE 1 (kcal):-186.2MFE 2 (kcal):-162.52MFE divergence-0.068