Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G302912-GRMZM2G340444
Species:maize
Duplication type:TD
Function (paralog1):zinc finger, C3HC4 type family protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.7053882863188
Log2 mRNA fold difference:2.4822887169889
Log2 TE fold difference:-0.82639756224557
Sequences
Protein sequence

MSTRGSGSLSPAAGASAAAPEVEGHWAPHGAVLTACVVGSNVLVILLVFGFFWRFFSGKG
GPSTSHGADDDDEEDSLPVASPWASRYRFEGHGARSTPMEDVVSSLPVSVYSSAGAEEGR
KARPECAVCIVELRDGDSVRVLPRCGHRFHANCVGAWLRRRTTCPLCRGRVVPPAAAALA
DKSRDAKDDVAVAADCPV*

MKQRYLPRFYLPSINLSSAFLICDLLLCCPFPLPSFISLSFICATLFLGDICDLFLQNLI
DLQIKLDHLLVAKPSWRFRKAVLPLVVYAHHWPLPLSWVWVVQYQHLVGAEAIMSTAGSG
SLRPAVVEDTGRHWAPHGPVLTACVVAINVLMILLVFVFFWRYFSGKRGPSASSGGGDGD
DDDASSSASLPVASPWAWSSRRRSSKDHGPQPVDDDVASALPVYVYSSSAGGEGGKAPEC
AVCILELRDGDSARLLPRCGHRFHADCVGAWLRLHATCPLCRASVVAPRAVAAADGSSRD
AKDDGADCLV*

Other information
Ka divergence:-0.0187306KaKs divergence:-0.239251
GC content 1 (%):71GC content 2 (%):62GC content divergence:-0.068
Length 1 (bp):597Length 2 (bp):933Length divergence:0.22
MFE 1 (kcal):-326.1MFE 2 (kcal):-413.61MFE divergence0.118