Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G303775-GRMZM2G400718
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277642
Function (paralog2):hypothetical protein LOC100278717

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.077984242718382
Log2 mRNA fold difference:1.3357470114492
Log2 TE fold difference:-1.2579593954888
Sequences
Protein sequence

MVAALGPGRFYGSGLPRPRFFPGDRVDPPASVTDPLLDWAREAHWSMGGFGVKRLRLQGR
IEGSIDKLRRRTRRDARAKTKARSAGHVPASLSPLGSEDEAEEVAAPERALVDDDVDSDG
SDESEGEEEDEPLAAIVTAAKKRRARKLSDEFDRIAAEQQYQLVVEKKRKAGAAKPARTS
PRKQASAPAAGSSPKRKQASAPAAGAPAMVSPKRKAAAPAAAPSSAAGARRTSPRNKH*

MVVALGPGRFYGSGLPRPRFFPGDRVDPPASVTDPLLEWAREAHWSMGGISVKRLRLQGR
IEGSVDKLRRRAHRDARVKAKAKARAAGHMPASLAALGSDDDASSGDSEDEQEVAARERA
LKRELVDDDEDSDGSGESEEDEPLAAIVTAAKKRRARKLSDEFDRIAAEQQQQLVLESKQ
KPGAATPATTSTKRKATVPRASPKRKASVPAAGAPARLSPKRKAAATAAAPLSAAGSRRT
SPRNKH*

Other information
Ka divergence:-0.108752KaKs divergence:0.15908
GC content 1 (%):73GC content 2 (%):71GC content divergence:-0.014
Length 1 (bp):717Length 2 (bp):741Length divergence:0.016
MFE 1 (kcal):-380.7MFE 2 (kcal):-386.8MFE divergence0.008