Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G305264-GRMZM2G417125
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383341
Function (paralog2):protein binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.32741251056705
Log2 mRNA fold difference:-0.15118954090915
Log2 TE fold difference:-0.1765177909475
Sequences
Protein sequence

MAEQAGVGRYWCHMCAAAVSPAEGEVEMKCPFCHSGFLEEMETARGAATDDGDGDGAVAQ
VHPGADRPSSIWAHAILSTVDSSARRRRNRRQQEAASDVYDWNDPEFSLRRRRVTAFLRL
LHELRDRQLQRLESAAGVALEGDQLTPFGRSLFIGAAGGEHGVALGDYFLGPSLDALVQQ
LAENDAARHGTPPAKKEAVEAMPTVEIAGGNDDDDAASCPVCLEDYAPGERAREMPCRHR
FHGNCIVPWLEMHSSCPVCRFQLPATDDKSSCSGGDGGFVSVDADREGSDNGGGDGRASS
PGNAELAEAEESGRRLPPSLQWLNSLFSPSAQSSGSGGSSSHHWEN*

MAEQAGAGRYWCHMCAAVVSPAEGEAEVKCPHCHSGFLEEMETVRGTPAADDGDGDGAVA
QVYPGADRPSSIWAHAILSTVDSSVRRRRNRRQTEAAGDVYDGNDPEFALRRRRVTAFLR
LLHELRDRQLQRLEAAAGVALEGDQLTPFGRSLFIGAAGGGEHGVALGDYFLGPSLDALV
QQLAENDAGRHGTPPAKKEAVEAMPTVEIAGGNGNDDDTASCPVCLEDYAAGERAREMPC
RHRFHSNCIVPWLEMHSSCPVCRFQLPATDDKGSCSSGDGGFVSVDADGEGNDNGGGDGR
ASIPGNAEPAEAEENGSRLPPSLQWLNSLFSPSAQSSGSGSGSSHHWEN*

Other information
Ka divergence:0.108508KaKs divergence:0.208283
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):1041Length 2 (bp):1050Length divergence:0.004
MFE 1 (kcal):-534.21MFE 2 (kcal):-536.5MFE divergence0.002