Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G305582-GRMZM2G315515
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193200
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0473488959662
Log2 mRNA fold difference:-3.1963590779695
Log2 TE fold difference:1.075073839053
Sequences
Protein sequence

MDYTNAIHIIPDAAGPDAWANAASAAGADASIWATEDDYRQWSAEPGYGDRNPSSRAGSE
QPPPGKKARGGGGGSDSGGGGSTSKSRAIGKMFFKTKLCCKFRAGTCPYVTNCNFAHGME
ELRKPPPNWQEIVAAHEEATEQREEHQIPIMTSGSVVAGDGGGGSGGGSQGGRAFKGRHC
KKFYTEEGCPYGDTCTFLHDEQSKARESVAISLSPTVGGGGYNAASANGVMVQKPSNWKT
RICNKWEMTGYCPFGSKCHFAHGSTAIIAELHKYGGGLVDIDGRDILSTPDSKQAGGSAK
APLESAAASTALPPHADVYHLGIQSQRSAIASQRSGQLQRPIQKWKGPDKISRIYGDWID
ENE*

MTGTPPRGRGASSRCLVRRLTAGAAAAMVAAGAAQASQRHRKMFFKTKLCCKFWARTCPY
VTNCNFAHGMEELCKPPPNWQEIVATHEDATTKQGEEHQIPIMTSRSVIAGDDGGGGRAY
KGRHCKKFYTEEGCPYGDTCTFLHDEQSKARESVAISLLPTIGGGGYNAASASGSMAQNS
SNWKTRICNKWEMTGYCPFGSKCHFAHGSTVIPNL*

Other information
Ka divergence:0.847146KaKs divergence:0.137237
GC content 1 (%):62GC content 2 (%):58GC content divergence:-0.033
Length 1 (bp):1092Length 2 (bp):648Length divergence:-0.255
MFE 1 (kcal):-491.1MFE 2 (kcal):-260.63MFE divergence-0.307