Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G309269-GRMZM2G491632
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):zinc finger protein 593

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7102564122807
Log2 mRNA fold difference:-0.39397772478625
Log2 TE fold difference:-1.473329983282
Sequences
Protein sequence

MGGKCPHRKVKKRRLSHKTARRGKFLLKADDAVYDELVKLADQGKDAEAKELPVDEDLPG
LGQFYCLHCEYALPLSSLSLPSIPPVCYFLSSANTETENYSCCTDCKAGIAEYVELLVDG
DVCKSLPFGICIENGL*

MGGKCPHRKVKKRRLSHKTARRGKFLLKADDAVYDELVKLADQGKDAEAKELPVDEDLPG
LGQFYCLHCDRYFASESVKDDHYRSKRHKKRVKVMSGPAPHTQLDAELAAGMGKPDNGLK
LMSM*

Other information
Ka divergence:-0.874454KaKs divergence:0.999137
GC content 1 (%):55GC content 2 (%):59GC content divergence:0.035
Length 1 (bp):411Length 2 (bp):375Length divergence:-0.046
MFE 1 (kcal):-137.14MFE 2 (kcal):-135.9MFE divergence-0.005