Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G309970-GRMZM2G378121
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304042
Function (paralog2):hypothetical protein LOC100278282

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.41129109240244
Log2 mRNA fold difference:1.2490125911297
Log2 TE fold difference:-0.85064844322807
Sequences
Protein sequence

MAEDAPNAAAEGGQPAPPEGSADAAPSATAGAKAAEALLPSLSIWPPSQRTRDAVVRRLV
QTLAAPSVLSQRYGAVPESEAERAAAAVEAEAFAAASKSAAAESPASIEEGIEVLQAYSK
EVSRRLLELAKTRSAAATVPAEGSAQEAEDSSATSPAAEEAAVKEE*

MAEDAPNAVAEGSQPAASEGSADAALPAAAGAKAAEALLPSLSIWPPSQRTRDAVVRRLV
QTLAAPSVLSQRYGAVPEPEAERAAVAVEAEAFAAASKSAAAAAECPASVEEGIEVLQAY
SKEVSRRLLELAKTRSAAAAAAPAPAEGSAQAQESAEASSATAPPTEEAAVNEE*

Other information
Ka divergence:-0.106346KaKs divergence:0.391517
GC content 1 (%):74GC content 2 (%):77GC content divergence:0.02
Length 1 (bp):501Length 2 (bp):525Length divergence:0.023
MFE 1 (kcal):-272.9MFE 2 (kcal):-286.29MFE divergence0.024