Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G310031-GRMZM2G339435
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278501
Function (paralog2):hypothetical protein LOC100277227

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.7879059024599
Log2 mRNA fold difference:4.1915260097462
Log2 TE fold difference:-2.3704463900962
Sequences
Protein sequence

MSGRAADPAALAAKGKLGELMWEHRVQAAVAVALVAAAAVSISVVGPRLSALVSFFWPLL
LSTGFFLVAVAVLLRISPPPAGDDDESGKELVDFVAWCRPEHLVPDAAAVEAPLEPET*

MATKGKLGELVWEHRVQAAAAVAFVAAAAVSISAVGPRLGAVVSFFWPLLVSTGLFLVAV
AVLLRISPPPAGDDDESGKELIDFVAGCRPEHLVPDAAPPAAVAPVEAPPELQI*

Other information
Ka divergence:-0.0189337KaKs divergence:0.501333
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):357Length 2 (bp):345Length divergence:-0.017
MFE 1 (kcal):-199.2MFE 2 (kcal):-184.5MFE divergence-0.038