Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G312061-GRMZM2G359581
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.8045540114755
Log2 mRNA fold difference:-2.6838342981035
Log2 TE fold difference:-0.18667236341016
Sequences
Protein sequence

MTKTIASPSRRQPLLAATAAWSWSGPRPPNLTSTCRKSKHMWPTELVGVAEPWSARAAGV
TTLSGQYVKIENVKDPYVQGVGEWAVKEHNRQTGESLEFAEVVSGMEQVVAGTNYKLNLA
TKDPTSSYQAVLPSSCV*

MAGEAGAGGSRSARAAENVKDPYVQGVGEWAVKEHNRQTGESLQFAEVVSGMEQVVAGTN
YKLNLATKDPTSSYQAVVFDPLPNSTKKRQLMSFKSI*

Other information
Ka divergence:-0.322188KaKs divergence:0.462628
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):414Length 2 (bp):294Length divergence:-0.169
MFE 1 (kcal):-160.6MFE 2 (kcal):-105.5MFE divergence-0.207