Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G312732-GRMZM2G312736
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100279071
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.38049672256192
Log2 mRNA fold difference:1.2560170284114
Log2 TE fold difference:-2.439365427991
Sequences
Protein sequence

MGLLEHPLEAVAFRLYSLPVPEASAATGAAAAWTCLAAAVLAAAAGVWRLCLSPSPPPSA
AVAAAANASGPDRSHVAEASPETSRRAPEPAAAAAATPKERYTAYYRDVGCCCCGGESDD
EEGDAEERGDGDVFLSDDDGPTTDPFGWEWEVVRSLQPPLSLAAETTGRRYRRSPTTGLG
GSVVQLWDQGAVRGLTPAARPRPRARVVVGTVSAF*

MGLLEHPLEAVAFRLYSLPVPEASAATGAAAAWTCLAAAVLAAAAGVWRLCLSLSPPPPP
SAAVAAAAANASEPDRSHVAEASPEPAAAAAATPKERYTAYYRDVGCCCCGGESDDEEDD
AEERGDGDVFLSDDDGPTTDPFGWEWEVVWSLQPPLSPVAETTGGRYRRSPTTGLGGSVV
QLWD*

Other information
Ka divergence:0.0607545KaKs divergence:0.408465
GC content 1 (%):75GC content 2 (%):74GC content divergence:-0.007
Length 1 (bp):648Length 2 (bp):555Length divergence:-0.077
MFE 1 (kcal):-387.3MFE 2 (kcal):-317.3MFE divergence-0.099