Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G314396-GRMZM2G321239
Species:maize
Duplication type:WGD
Function (paralog1):calcium dependent protein kinase
Function (paralog2):CDPK protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.2954817258378
Log2 mRNA fold difference:1.6894420278366
Log2 TE fold difference:-0.4120360565792
Sequences
Protein sequence

MGNACSGALRSKYLHSFKHAASQRHDSEYSASADDSPRKPTPPATTDAHAPAPPAAAMRR
GAAGATPDLGSVLGHPTPNLRDLYALGRKLGQGQFGTTYLCTELATGIDYACKSISKRKL
ITKEDVDDVRREIQIMHHLSGHKNVVAIKGAYEDQVYVHIVMELCAGGELFDRIIQRGHY
SERKAAALTRIIVGVVEACHSLGVMHRDLKPENFLLANRDDDLSLKAIDFGLSVFFKPGQ
VFTDVVGSPYYVAPEVLLKSYGPAADVWTAGVILYILLSGVPPFWAETQQGIFDAVLKGA
IDFDSDPWPVISDSAKDLIRRMLNPRSAERLTAHEVLCHPWIRDHGVAPDRPLDPAVLSR
IKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFQIMDTDNSGAITYDELKEGLRKYGST
LKDTEIRDLMEAADIDNSGTIDYIEFIAATLHLNKLEREEHLVAAFSYFDKDGSGYITVD
ELQQACKEHNMPDAFLDDVINEADQDNDGRIDYGEFVAMMTKGNMGVGRRTMRNSLNISM
RDAPGAF*

MGNACGGALRSKYQHSFKHAASSQRRASSEYSASAVADDSPRKPTQPPATTDAHAPPPPP
ATAAAAMRRGGAGAPPDLGSVLGHPTPNLRDLYALGRKLGQGQFGTTFLCTELATGVDYA
CKSISKRKLITREDVDDVRREIQIMHHLSGHTNVVAIKGAYEDQLYVHIVMELCAGGELF
DRIIQRGHYSERKAAELTRIIVGVVEACHSLGVMHRDLKPENFLLVNKDDDLSLKAIDFG
LSVFFKPGQVFTDVVGSPYYVAPEVLLKNYGPAADVWTAGVILYILLSGVPPFWAETQQG
IFDAVLKGVIDFDSDPWPVISDSAKDLIRRMLNPRSAKRLTAHEVLCHPWIRDHGVAPDR
PLDPAVLSRIKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFQTMDTDNSGAITYDELK
EGLRKYGSTLKDTEIRDLMDAADIDNNGTIDYIEFIAATLHLNKLEREEHLVAAFSYFDK
DGSGYITVDELQQACKEHNMPDAFLDDVINEADQDNDGRIDYGEFVAMMTKGNMGVGRRT
MRNSLNISMRDAPGAF*

Other information
Ka divergence:-0.0492112KaKs divergence:-0.270939
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):1644Length 2 (bp):1671Length divergence:0.008
MFE 1 (kcal):-583.52MFE 2 (kcal):-613.22MFE divergence0.025