Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G314546-GRMZM2G351018
Species:maize
Duplication type:WGD
Function (paralog1):homeobox3
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.39448921354758
Log2 mRNA fold difference:0.36265508420557
Log2 TE fold difference:-0.76438335292592
Sequences
Protein sequence

MGRKGSEVSPSKRYPLRSAHSSGRVLRSALANNNKDSEPLNAAAATQAAVKKRSGNQLDS
PNSTVRLLRSTSKNKDEAHSGPLNDRIIDKPAANKRKHANPSQVGSPSSSVRVLRSAIKN
KDMARSEPQSDRTAGEAATNKRKNANSSKVGSLSSGLSVLRSASKAKDETCIKPLNDSAA
VEPASSKRKCTSPSKVGSPSNSVRVLRSTSKYKNETCTEPLNDSGAVEPAANRRKGVSRS
KEGSPNSSVRVLRSASNNKIDVSIEPLNNSTTGQPAAKRRKNGSSFKSSARVLCSTSERA
NEASSEPLNDSTAAQPAARKKKGGAMPKTDNPKIGVRVLRSASGKKNETCTEPVNGSTSA
EPTVTKKRNCKPSKDRSPKKDYLKICQRIKYILNRMKYEQAFIQAYASEGWKGQSLEKIR
PEKELERAKAEILQCKLRIREAFRNMDSLLSKGKLEESLFDSAGQISSEDIFCAICGSKD
VTSQNDIILCDGACDRGFHQNCLSPPLLTEEIPPGDEGWLCPACVCKADYIDALNELQGS
KLSIHDSWVKVFPEAASTANGSKQVDASDLLPDHIKDSANLALVGTHMVNEIRFSEEDDS
KADDLGLPSEDSGDGDFDPAGPDSSEDQNDGLNSEESDFTSDSDYFCAEIAKSCGQDEVS
ASPLSNVINRTDRMKLRAYSRRSNEENHNHAFMDMELEQDIVLPVPSRRQVERLDYKKLY
DEAYEEESSNSSDEEEWSGKELLEGSGTDSLDERLRPVKRCSRRAPAGQQNNELTPQSRP
HGSNSEQKTEVLRSNGSSSTGRKYDPEVTQKLKVHFEKDPYPSRETKENLSEELGLTFNQ
VSKWFSSTRHYSRVASAKKEMHPDSHTCENNDETTVDSMQAKQPNAGVMEKLTGDRNGIV
PEKPMVQDNLNQGAMEKLTRDKNDIVPEKPVMQSSLNQCNNEDIPLSGTEIEMESYEQES
SDSSDEEWSILSTPRKTRLQDHGKSSVTESLRSAKRCSRRAPAREQNNERIQSEQLHGSA
SEQQTEFLRSNVSSGKVSKYHFGPIVSQKLKEHFEKDPYPCRATKESLAQELGLTFNQIS
KWFSGTRHYSRDAVAKNQKRPGENTTVNNNSTTFDDIQVIEPNVGLIDKPAADVNDMISE
KLMVQINLNEGIEEDIPPSQYARCEEKITMTPAAISREAGLPGYGPGPGENFLQVSSRNT
SCEQSVILAPTAIAREVGPPGYATGENQGNGAPWNTSYERRLFMNPVTSSRAVSPPGYGP
EESRGSGISWNTSSEQILFMSPTTISRELGPPGYGPREDQCSGTSWNASCELGVFMSPVT
TSREDSPPGYGPRENQENDNMRCELRMFTSPTTISREVGPPGYELTGKNKGNGASCTTNY
QQGAFTSPEAFPREACPPGFVSGENQGNDTPWYMSSKQMAFTSPTTNPRVGPPGYGQENQ
GSRVSWNTSYEQGVFMSSTNISREAGPPGYGPGESQGNITSWISTGGQRMFTGPSTIPNE
VGQQGYGPSGIPGTDGSRSMDLKAFPPGYGPAGENQGGGASGSVISPQARSAENVEFSDD
ARKKAIQRELRRRQKFR*

MGRKGSEMSPSKRYPLRSPHSSGRVLRSALANDNKDSEPLNAAAATQAAVKKRSGSQLDS
PNSSVRLFHSTSKNKNEACSGPLNDRIPDKPAANKRKRASPSQVGSSSNSVRVLRSAIKN
KDEACSKSLSDRTAGEPAANKRKNVNRSKTGSLSCGVRVLLSASKAKDETSTKPLNDSAA
VEPASGKRKGTSPSKVGSASNSVRVLRSTSKYKNETCTEPLNDSGAVEPAANKRKGVSRS
KKRSLNSSVRVLRSASNNKIEVSIKPLGNSTAGQPAAKRRKSGSSFEAGSPVSSARVLRS
TSERKNEASKPLNESTAAQPAARKKKAGVISKTDNPKIGLRVLRSASGKKNEACIGHVND
STSAEPTVTKRNRKPSMDRSPKKDYLKICQRVRYILNRMNYQQTFIQAYASEGWKGQSLE
KIRPEKELERAKAEILQCKLRIREAFRNMDSLLSKGKLEESLFDSAGEISSEDVGVPPGD
QRWLCPACVCKADSIDALNELQGSKLSIHDSWEKVFPEAASIANGSKQVDTSDLLPDHIK
HSDNPALVEGLMVNEVRLSAEDDSKADDLGLPSEDSGDGDFDPSGPDSSEDQKDGLNSEE
SDFTSDSDDFCAEIAKSCGQDEVSASPLSNVINHTYRMKLRASNNRSNEENHDHVFMDME
LGQDMVLPVSSRRQVERLDYKKLYDEAYGKESSNSSDDKEWSGKELLEGSETDSLSERPH
PVKRCSRRAQAEQQNNEHTPQRERLHGSESEQKTGILRSNGSSSTGRKFGPVATQKLKVH
FEKDPYPSRETKENISEELGLTFNQVSRWFSSTRHYSRVASARKEMHPDGHTSENNDTTT
VDSMQARQPNTVVMEKLTGNRNDIVSEKPMVQNNLNQGVAEKLTRDRNDIVPEKQVVQSN
LNQCNNEDIPLSGTEIEMESYEQESSESSDEEWSTLSTPRKTKLQGNEKVSLTESLRSAK
RCSRRAPAREQNNEHTQSEQLHGSASEQQAREQLHGSVSKQQTEVLRSNVSSGDASKCHF
GPIVTQKLKEHFEKDPYPCRATKEGLAQELGLTFNQISKWFSATHHYSRDAVAKNQKYPG
ENTTENNSSTIFDGIQVIEPNFGLIDKPDADTNDMISEKLMVQINLNEGIEEDIPPSQYT
TRCEEKLTMTQAAISREAGPPGYGPGENFLQVSSRITSCEQSVIMAPSAIARGVGPPGYT
PGEHQGNGAPWNTSYERRPFTSPTTSSREVGPPGYGPEENQGSGISCNTSREQILFMSPT
TISRELGPPGYLPRENQRSDTSWNTSCESGLFMSPATTSIEHGPPGYGPGENQENDSTSC
ELRMFTSPTIVSREVGPPGYQQGVFMSPKTISREVCPPGFGSGENQGNDTTWYKQSAFTS
PTTISREVGPPGYGQEDQGNGGSWNTSCEQGVFTSPTRGISREVGPPGYGPGESQGNTTS
WISTCQQRMLAGIQRTGGSRSMDLEAFPPGYGPGGASGSVISPQARSAENVEFSDEARKK
AIQRELRRRQKFR*

Other information
Ka divergence:-0.109326KaKs divergence:-0.184366
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):4734Length 2 (bp):4542Length divergence:-0.021
MFE 1 (kcal):-1469.51MFE 2 (kcal):-1452.44MFE divergence-0.006