Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G318408-GRMZM2G397684
Species:maize
Duplication type:WGD
Function (paralog1):RING zinc finger protein-like
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.2960918522563
Log2 mRNA fold difference:-2.4399143296395
Log2 TE fold difference:-0.74892586712039
Sequences
Protein sequence

MGFPVGYSELVLPKQLLHLLLLLGYIRRFLLWAFDAVGLGDLLDLGDDHQALLQDHQQQQ
HGAAAQGRDLPQQAAMLQHRRPEFRAVPAMVIEEVLPVVRFDELELEPEPGDCAVCLSGI
GGRDEVRRLSNCRHVFHRACLDRWMEHDQRTCPLCRAPLIPDEMAGALWAAAAGVPDASD
FDFSYLGAPLAPVPSPTLLRPHELLLTGLGGYQ*

MGFPAGYSELVLPKQLLHLLLLLGYVRRFLLWAFDAVGLGDLLDLGDDHQAPQPQPQHRR
AEFRAAMPAMVIEEALPVARFDELEARVVVGGDCAVCLGGIGGGDEVRRLGNCRHAFHRA
CLDRWMEHDQRTCPLCRAPLIPGAALWPADASDLDFSYPGAPLTPVVPSPTLLRPHELLL
LAGLGGY*

Other information
Ka divergence:0.561495KaKs divergence:0.577382
GC content 1 (%):73GC content 2 (%):74GC content divergence:0.007
Length 1 (bp):642Length 2 (bp):564Length divergence:-0.065
MFE 1 (kcal):-346.7MFE 2 (kcal):-304.2MFE divergence-0.065