Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G320827-GRMZM2G427087
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277445
Function (paralog2):hypothetical protein LOC100279100

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.1568429761965
Log2 mRNA fold difference:-0.30887533043428
Log2 TE fold difference:-1.7122729498895
Sequences
Protein sequence

MASPSPSSPARASGRRVPPPCWTTDETLALARAYTARRLAVGREHLTSTDWAAVAAAAPS
KTARQCRHKIEKLRRRLRSNRRRPCPLLDAMDLLDGPSPPFFSKSQSRSTSLSSSPPPPA
AVSTPSPPSPPASPPRKRRRDDAWDEDGVSDVVGALRAIGEGFLRAEERRMEAARETQRM
RMEMALRHLDAQRRLMDALVGRIIDALD*

MASPSPARASGRRVPPPCWTTDETLALARAYTARRLAVGREHLTSADWAAVAAAAPSKTA
RQCRHKVEKLRRRLRSNRRRPCPLLDAIDLLDVPSPPFFSKSQSRSTSRSSSPPPPAAAI
SSPSPPSPPASPPRKRRRDDAGDEDGVSDVVGALRAIGEGFLRAEERRMEAARETQRMRM
EMALRHLDAQRRLMDALVGRIVDALD*

Other information
Ka divergence:-0.455741KaKs divergence:-0.735304
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):627Length 2 (bp):621Length divergence:-0.005
MFE 1 (kcal):-304.1MFE 2 (kcal):-294.9MFE divergence-0.015