Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G323888-GRMZM2G352618
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100275074
Function (paralog2):hypothetical protein LOC100277700

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.51120086658096
Log2 mRNA fold difference:0.38174159674094
Log2 TE fold difference:0.21462884455503
Sequences
Protein sequence

MAMAPCAPASVSSFPARPVRAPSAVRPRAAAIRATAAAAEGGRWWAPLLGWSGKADYLEA
PAPVPAVLQDDDAAAARRQFVGGLTEEKARQLRARMAQTESFHDAMYHSAIASRLARSA*

MAMAPSAACVVSFPARPAASTAGPRAAAGAGAVHAFAGSAEGAKWWAPLLGWSGKADYLE
APAPAPAGAQDEAPRRQFVGVMTEEKARELRARMAQTESFHDAMYHSAIASRLARSS*

Other information
Ka divergence:0.0309903KaKs divergence:0.917951
GC content 1 (%):76GC content 2 (%):77GC content divergence:0.007
Length 1 (bp):360Length 2 (bp):354Length divergence:-0.008
MFE 1 (kcal):-202.4MFE 2 (kcal):-207.7MFE divergence0.013