Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G328168-GRMZM5G805526
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284182
Function (paralog2):LOC100282946

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.3797898961691
Log2 mRNA fold difference:3.0148729320853
Log2 TE fold difference:-0.75525506241174
Sequences
Protein sequence

MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAYKRMQYNRRFVTAVVGFGKKRGPNSS
EK*

MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS
EK*

Other information
Ka divergence:-1KaKs divergence:-0.994595
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):189Length 2 (bp):189Length divergence:0
MFE 1 (kcal):-73.7MFE 2 (kcal):-71.8MFE divergence-0.013