Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G328500-GRMZM5G862540
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279549
Function (paralog2):LOC100282847

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.49274068543575
Log2 mRNA fold difference:0.12119325870023
Log2 TE fold difference:0.36390384795746
Sequences
Protein sequence

MLRVCVLLYKSLMKHLLRLQVTDLSDKMVKICCIGAGYVGGPTMAVIALKCPDIEVVVVD
ISKPRIEAWNSDTLPIYEPGLDDVVKQCRGRNLFFSTDVEKHVAEADIIFVSVNTPTKTR
GLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGINYQIL
SNPEFLAEGTAIEDLFKPDRVLIGGRETPEGRKAVQALKDVYAHWVPEDRILTTNLWSAE
LSKLAANAFLAQRISSVNAISALCEATGANVTEVAYAVGKDTRIGPKFLNASVGFGGSCF
QKDILNLVYICECNGLPEVANYWKQVIKINDYQKSRFVNRVVSSMFNTVAGKKIAVLGFA
FKKDTGDTRETPAIDVCKGLLGDKAQISIYDPQVTEDQIQRDLAMNKFDWDHPMHLQPTS
PTAVKQVSCVWDAYEATKGAHGLCILTEWDEFKTLDYQKIFDNMQKPAFVFDGRNIVDSE
KLREIGFIVYSIGKPLDAWLKDMPAVA*

MVKICCIGAGYVGGPTMAVIALKCPDIEVVVVDISKPRIEAWNSDTLPIYEPGLDDVVKQ
CRGRNLFFSTDVEKHVAEADIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSD
KIVVEKSTVPVKTAEAIEKILTHNSKGINYQILSNPEFLAEGTAIEDLFKPDRVLIGGRE
TPEGRKAVQVLKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAISALCEAT
GANVSEVAYAVGKDTRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI
RINDYQKSRFVNRVVASMFNTVAGKKIAVLGFAFKKDTGDTRETPAIDVCKGLLGDKAQI
SIYDPQVTEDQIQRDLAMNKFDWDHPMHLQPTSPTAIKQVSCVWDAYEATKGAHGVCILT
EWDEFKTLDYQKIFDNMQKPAFVFDGRNIVDPEKLREIGFIVYSIGKPLDAWLKDMPAVA
*

Other information
Ka divergence:1KaKs divergence:0.991489
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):1524Length 2 (bp):1443Length divergence:-0.027
MFE 1 (kcal):-612.6MFE 2 (kcal):-575.31MFE divergence-0.031