Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G333433-GRMZM5G873277
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384249
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.33606959131381
Log2 mRNA fold difference:-0.96071640701331
Log2 TE fold difference:0.74279780516282
Sequences
Protein sequence

MGCVHGRPATSSPAPAATSSSRRDHPTASQTHKDGVDSAAAAPPVDAEAPEQQAAEKPQK
VKRERRSRSSRSAAFAAHTEVRLGGSFANKARGEQVAAGWPAWLSAVAGEAIEGWTPRRA
DSFEKIDKIGQGTYSNVYKARDSLSGKIVALKKVRFDNLEPESVRFMAREILILRRLDHP
NVVKLDGLVTSRMSCSLYLVFDYMVHDLAGLAASPDIKFTLPQVKCYVHQLLSGLEHCHN
RGVLHRDIKGSNLLLDNNGVLKIADFGLASFFDPNHKQPMTSRVVTLWYRPPELLLGATD
YGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATIFK
PQQPYKRRIADTFKDFPQSALRLIETLLAIDPADRLTATSALNSDFFATEPYACEPSSLP
QYPPSKEMDAKRRDEEARRLRAAGGRGNGDGTRKTRTRDRPRAVPAPEANAELQANIDKR
RLITHANAKSKSEKFPPPHQDGALGFPLGCSNHMEPSFEPPDPSSFSTVFPFEKSAVPTW
SGPLADSAAGNQKRKHKSARSSKQPATARAR*

MGCVHGRPTTSSPAPAATSSRRRDQPAASQPHQEGVDSSDAAPPADAAAPEQPAAEKPEK
VKRERRSRSSRSAATAAAAHAEVRLGGSFANKARGEQVAAGWPAWLSAVAGEAIDGWTPR
RADSFEKIDKIGQGTYSNVYKARDSLSGKIVALKKVRFDNLEPESVRFMAREILILRRLD
HPNVIKLDGLVTSRMSCSLYLVFDYMVHDLAGLAASPDIKFTLPQVKCYMRQLLSGLEHC
HNRGVLHRDIKGSNLLLDNNGVLKIGDFGLASFFDPNHKQPMTSRVVTLWYRPPELLLGA
TDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIFKLCGSPTEEYWKKSKLPHATI
FKPQQPYKRRIADTFKDFPQSALRLIETLLAIDPSDRLTATSALNSDFFKTEPYACEPSS
LPQYPPSKEMDAKRRDEEARRLKAAGGRANGDGTRKTRTRDRPRAVPAPEANAELQANID
KRRLITHANAKSKSEKFPPPHQDGALGFPLGCSNHMEPSFEPPDPSSFSTVFPYEKSTVP
TWSGPLADSAAGNQKRKHKSGRSSKQPATARAR*

Other information
Ka divergence:0.0296029KaKs divergence:0.155187
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):1716Length 2 (bp):1722Length divergence:0.002
MFE 1 (kcal):-658.53MFE 2 (kcal):-670.5MFE divergence0.009