Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G333916-GRMZM2G334041
Species:maize
Duplication type:TD
Function (paralog1):Cytosine-specific methyltransferase (EC 2.1.1.37)
Function (paralog2):DNA methyl transferase1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.040667649243842
Log2 mRNA fold difference:0.0089801131302668
Log2 TE fold difference:-0.054703738897397
Sequences
Protein sequence

MLTNDFSGTRRCRAKPQKKEEESTENNKLENGSLDATEEVHHGVEKGDGHVTRKRPRRSA
ACSDFKEKSIRLSEKKSVVMVKKNRMEEEEVDAVNLTKLGPEDPPPCRKLIDFILHDAEG
NPQPFEMSEIDDFFITALIMPMDDDLEKERERGVRCEGFGRIEDWNISGYDEGTPVIWVS
TDVADYECVKPSTNYKSYFDHFYEKAQVCVEVFKKLAKSVGGNPNQGLDELLASVVRSTN
AMKGYSGTMSKDLVISIGEFVYNQLVGLDETSNNDDEKFATLPVLLSLRDQCRSRVELTK
LPSNFSNTSLKIKDSECDETAEDDDDAKLARLLQQEEEWKMMKKQRGRRGTPSQKNVYIK
ISEAEIANDYPLPAYYKPFSQEMDEYIFDSDDSIFSDDVPVRILNNWTLYNADSRLISLE
LIPMKSGAENDVVIFGSGFMRDDDGSCCSTAESVKSSSSSSKADQLDAGIPIYLSPIKEW
IIEFGGSMICITIRTDVAWYKLRQPTKQYAPWCEPVLKTARLAVSIITLLKEQSRASKLS
FADVIRKVAEFDKGNPAFISSNITLVERYIVVHGQIILQQFADFPDETIRRSAFVSGLLL
KMEQRRHTKLVMKKKTQVMRGENLNPSAAMGPASRKKAMRATTTRLINRIWSDYYAHHFP
EDSKEGDGNETKEIDDEQEENEDEDAEDEGQIEENISKTPPSTRSRKLLSQTCKEIRWEG
ETSGKTLSGETLYKCAYVRELRIPVGGTVALEDDSGDTVICFVEYMFQKVDGSKMVHGRI
LQKGSQTILGNAANEREVFLTNDCLEFKLDDIKELVMVDIQSRPWGHKYRKENSEADKVE
QVKAEERKKKGQPMVYFCKSLYWPEKGAFFALSRDKMGLGSGLCSSCDNIEPDSDELKIF
SKTSFVYRKVTYNVNEFLYIRPDFFAEDEDRATFKAGRNVGLKPYAVCQILSIPEGAGSK
KLNPASANISARRFYRPDDISSAKAYASDIREVYYSEDVIDVPVDMIEGKCEVRKKNDLA
SSDLPVMFEHVFFCELIYDRASGALKQLPPNVRFMSMVQRTSALKKNKGKQICEPDQIDS
GKWLDVPKENRLATLDIFAGCGGLSEGLQQAGVSFTKWAIEYEEPAGEAFNKNHPEAVVF
VDNCNVILKAIMDKCGDTDDCVSTSEAAEQAAKLPEVNINNLPVPGEVEFINGGPPCQGF
SGMNRFNQSPWSKVQCEMILAFLSFAEYFRPRFFLLENVRNFVSFNKGQTFRLAVASLLE
MGYQVRFGILEAGAFGVAQSRKRAFIWAAAPGEMLPDWPEPMHVFASPELKITLPDGQYY
AAARSTAGGAPFRAITVRDTIGDLPKVGNGASKLTLEYGGEPVSWFQKKIRGNMMVLNDH
ISKEMNELNLIRCQHIPKRPGCDWHDLPDEKVKLSNGQMADLIPWCLPNTAKRHNQWKGL
YGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQDRIITVRECARSQGFPDSYEFAGNIQNKH
RQIGNAVPPPLAYALGRKLKEAVDKRQEASAGVPAP*

MLTNDFSGTRRCRAKPQKKEEESTENNKLENGPLDATEEVHHGVEKGDGHVTRKRPRRAA
ACSDFKEKSIRLSEKKSVVMVKKNRMEEEEVDAVNLTKLGPEDPPPCRKLIDFILHDAEG
NPQPFEMSEIDDFFITALIMPMDDDLEKEREKGVRCEGFGRIEDWNISGYDEGTPVIWVS
TDVADYECVKPSTNYKSYFDHFYEKAQVCVEVFKKLAKSVGGNPNQGLDELLASVVRSTN
AMKGYSGTMSKDLVISIGEFVYNQLVGLDETSNNDDEKFATLPVLLSLRDQCRSRVELTK
LPSNFSNTSLKIKDSECDETAEDDDDAKLARLLQQEEEWKMMKKQRGRRGTPSQKNVYIK
ISEAEIANDYPLPAYYKPFSQEMDEYIFDSDDSIFSDDVPVRILNNWTLYNADSRLISLE
LIPMKSGAENDVVVFGSGFMRDDDGSCCSTAESVKSSSSSSKADQLDAGIPIYLSPIKEW
IIEFGGSMICITIRTDVAWYKLRQPTKQYAPWCEPVLKTARLAVSIITLLKEQSRASKLS
FADVIRKVAEFDKGNPAFISSNITLVERYIVVHGQIILQQFADFPDETIRRSAFVSGLLL
KMEQRRHTKLVMKKKTQVMRGENLNPSAAMGPASRKKAMRATTTRLINRIWSDYYAHHFP
EDSKEGDGNEIKEIDDEQEENEDEDAEDEGQIEENISKTPPSTRSRKLLSQTCKEIRWEG
ETSGKTLSGETLYKCAYVRELRIPVGGTVALEDDSGDTVMCFVEYMFQKVDGSKMVHGRI
LQKGSQTILDNAANEREVFLTNDCLEFKLDDIKELVMVDIQSRPWGHKYRKENSEADKVE
QVKAEERKKKGQPMVYFCKSLYWPEKGAFFALSRDKMGLGSGLCSSCDNIEPDSDELKIF
SKTSFVYRKVTYNVNEFLYISPDFFAEDEDRATFKAGRNVGLKPYAVCQILSIPEGAGSK
KLNPASANISARRFYRPDDISSAKAYASDIREVYYSEDVIDVPVDMIEGKCEVRKKNDLA
SSDLPVMFEHVFFCELIYDRASGALKQLPPNVRFMSMVQRTSALKKNKGKQICEPDQIDS
GKWLDVPKENRLATLDIFAGCGGLSEGLQQAGVSFTKWAIEYEEPAGEAFNKNHPEAVVF
VDNCNVILKAIMDKCGDTDDCVSTSEAAEQAAKLPEVNINNLPVPGEVEFINGGPPCQGF
SGMNRFNQSPWSKVQCEMILAFLSFAEYFRPRFFLLENVRNFVSFNKGQTFRLAVASLLE
MGYQVRFGILEAGAFGVAQSRKRAFIWAAAPGEMLPDWPEPMHVFASPELKITLPDGQYY
AAARSTAGGAPFRAITVRDTVGDLPKVGNGASKLTLEYGGEPVSWFQKKIRGNMMVLNDH
ISKEMNELNLIRCQHIPKRPGCDWHDLPDEKVKLSNGQMADLIPWCLPNTAKRHNQWKGL
YGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQDRIITVRECARSQGFPDSYEFAGNIQNKH
RQIGNAVPPPLAYALGRKLKEAVDKRQEASAGVPAP*

Other information
Ka divergence:0.142857KaKs divergence:-0.0506777
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):4611Length 2 (bp):4611Length divergence:0
MFE 1 (kcal):-1415.39MFE 2 (kcal):-1409.71MFE divergence-0.002