Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G341302-GRMZM2G341304
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7821293417898
Log2 mRNA fold difference:-1.2598854792357
Log2 TE fold difference:-0.49562241938716
Sequences
Protein sequence

MLVMAMKHTSFLPYLLLLTTLASCDDQFLLSGFTQSSLNLDGSAIVTNDGLLDLTNSTAI
TNGHAFYPSPLHFRKSPDGKVESFSVNVVFSIFITYPDLSADGMAFFIAPTKNFSDARAG
KYFGLLNENNNGNTRNHIFMVELDTYKNAEVQDINDNHVGININGVFSFKSNTSGFYEDS
GAFRELTLNGNKGTQLWIDYDKSTMQINVTLAPINVHKPSRPLLSTTYDLSTVISTSTSY
IGFASGASPVNSRHYVMGWSFGMNKPAPPLDVSKLPKLPFHGPKAQSKLLAIVLPIATAT
LILSIGTIVTLVVRRRLKYAEVREDWEGEFGPHRFSYKDLYHATGGFKNKHLLGEGGFGK
VYKGVLPLSNVEVAVKRMSHESRQGMKEFVTEVVSIGRLRHRNLVQLLGYCRRKGELFLV
YNYMPNGSLDKYLYCEEHGAILNWEQRFRVIRNIATVLLYLHEKWEKIVIHRDIKASNVL
LDGEMNGRLGDFGLARLYDHGTDPQTTHMVGTKGYLAPELLRTGKASPHTDVFAFGMFLL
EVACGQRPVKKNAEGTEFFLVDWVLEHWNNGVITKTLDSRLQGDYNIDEAHLVLKLGLLC
SHPLPSSRPRMRQVMQYLDGDTPLPELRPTQLSSNMVALMKNSGLNSSVVSYPQISTSFC
TISSLSGGR*

MAVFDMKSAPLMILELLLVSLGLTIAPFSAEENNDHWFVYSGFANASLTLDNTASITPSG
LLELTNGTVMSMGHAFYPTPLRLRDSPNSTVQSFSASFVFGIISIYDDLSSHGLAMLIAP
SRTLSALPVQYLGLLSGSNDGNKSNHIFAVELDTYQNSEFKDINNNHIGIDINSMTSVQS
NPAGFFHDQDGTFENLTLSSKEAMRVWVEYDRENTQIDVTMAPLAIVKPKRPTVSTIQNL
SDVLTDVAYVGFSSSTGKIHTQHYVLGWSFAMNGPAPSIDLSMLPKLPRHHHKSRRSWVL
ETVLPIATAALLLSLGVVAFLLVRRHVRYAEIREDWELEFGPHRFSYKDLFHATGGFENK
NLLGIGGFGRVYKGELPRSRLKIAVKRVSHDSKQGMKEFIAEIVSIGRLQNRNLVQLLGY
CRRKGELLLVYEYMPNGSLDKYLHNAKEGNSALSWAQRFRIIKGIASGLLYLHEEWEKVV
VHRDIKGSNVLLDSEMNGRLGDFGLARLYDHGVDPQTTHVVGTIGYLAPKLARGGNATPL
TDVFSFGMFVLEVTCGQRPVRHENVQDSQLMLVDWVLDKVREGSFGATMDARLEGKYDIG
EAYLALKIGLLCSHPFASERPTMRQVIQYLDGEIEAPDLSFEVLASMQSEGIDPYLISYP
LSTECFSTTSNVVSGGR*

Other information
Ka divergence:0.0394866KaKs divergence:-0.0330403
GC content 1 (%):48GC content 2 (%):52GC content divergence:0.04
Length 1 (bp):2010Length 2 (bp):2034Length divergence:0.006
MFE 1 (kcal):-641.13MFE 2 (kcal):-698.07MFE divergence0.043