Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G344630-GRMZM2G433137
Species:maize
Duplication type:WGD
Function (paralog1):GTP binding protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.467236950078
Log2 mRNA fold difference:-0.89063125460081
Log2 TE fold difference:-0.60124139627358
Sequences
Protein sequence

MAKVHPNVLLSSSSPAEGAAAAAAGGEGEETSLTVWRKSLLFNCRGYTVFDARGDLAYRA
DSYDAEAEVVLMDPAGRPAFTVRRRRLSLSGEQWLIYAGEETRRPAYAVKRGGGGGKSVA
RVTPCAAVPAAAGAAALPAYEVEGSYARRRCVVYDAHQRRAVAEVQPKEAVGSDVFRLVV
QPGVDVSLAMAVVVALDQLFGRPSLLRSWSSP*

MAKVHPDRHPNVLPPSPAEEKEEEATSLTVWRKSLLFNCRGYTVFDGRGDLAYRVDSYDD
AGADAGAVLMDPAGRPAFTVARRSRLLGLLSGQQRLIYAGEDTRRPAVYAVVRRRGKATA
RVTPCAAAGAAYEVEGSYARRRCVVYDAERRVVVAEVRPKEAVVGTDVFRLVVRPGFDVS
LAMAVVVALDQLFGGRPSLLRSWSTM*

Other information
Ka divergence:0.485032KaKs divergence:0.312214
GC content 1 (%):74GC content 2 (%):73GC content divergence:-0.007
Length 1 (bp):639Length 2 (bp):621Length divergence:-0.014
MFE 1 (kcal):-388.9MFE 2 (kcal):-348.5MFE divergence-0.055