Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G348125-GRMZM2G410766
Species:maize
Duplication type:TD
Function (paralog1):stress responsive protein (LOC100283176), mRNA
Function (paralog2):Stress responsive protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.14412552492818
Log2 mRNA fold difference:0.022631242121817
Log2 TE fold difference:0.11450445175386
Sequences
Protein sequence

MDGGYYGGRDQRYSGGYYGGGGIATPGYAPAVPYGMSQVNIEGNGCGRALPPQPTVKVYC
RANPNYAMSVRDGKVVLAPANPKDEYQHWIKDMRWSTSIKDEEGYPAFALVNKATGEAIK
HSLGQSHPVRLVPYNPDFLDESVLWTESRDVGNGFRCVRMVNNIYLNFDALHGDKWHGGV
RDGTDVVLWKWCEGDNQRWKIQPYY*

MHHQWGSWGRREQPAAPYKSAGPAVALSASGPLDHQSPEELLIEVSEVEKQAANKGTIVM
DGGYYGGRDQRYSGGYYGGGGIATPGYAPAVPYGMSQVNIEGNGCGRALPPQPTVKVYCR
ANPNYAMSVRDGKVVLAPANPKDEYQHWIKDMRWSTSIKDEEGYPAFALVNKATGEAIKH
SLGQSHPVRLVPYNPDFLDESVLWTESRDVGNGFRCVRMVNNIYLNFDALHGDKWHGGVR
DGTNVVLWKWCEGDNQRWKIQPYY*

Other information
Ka divergence:1KaKs divergence:1
GC content 1 (%):66GC content 2 (%):65GC content divergence:-0.008
Length 1 (bp):618Length 2 (bp):795Length divergence:0.125
MFE 1 (kcal):-285.3MFE 2 (kcal):-372.31MFE divergence0.132