Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G354053-GRMZM2G359331
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275709 (LOC100275709), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.35298317394279
Log2 mRNA fold difference:0.67260906903439
Log2 TE fold difference:-0.31886644272308
Sequences
Protein sequence

MQGSNTKSSSAEAKSNSKPDKEKKGGGGGTPPTPKDSKPRKPAVPKASAAGHGTPRAADK
SPGSGSADRKAPTPKAAASRLATPPEKGKPAKRPQEQQAQLAEIREELVKAKEQLLENEK
EKCRVLAELERAKKVADEANAKLQDALDVQRRAIEAQEADKLPAGESKQASIHDQQEDDD
AVLRSTVEQLEKARYELADAVDAKNEALSQVDDAVRASEVKAQEVEHLIAEVTRLKGLVD
SKVDGNRKKTAERIQNLEEENFALKLELQKKKAAEEKAVRLERMIDELESDVDDARNFGS
KSKQLADEWQKKAQLLEVRLEEADQSNILKGESLNSAMEELDSTSSLLRDRESEVAALRD
KVRFFEDEQTKLKNDIVVSGQRADAAEKEAADLWTEVEGLRLKLHTVEEEKMEALNSDKS
TTLETETLNEQKNQLTDKLEANKDELEKTKKAMEGLASALQEMSAESREAQEKYLLKQDE
IERAQAQVEELSLSLKNTKENYELLLDEANYEKVCLTKTVERLKAEAKSAHEEWHSKELS
FVNSIKNSEEEIVAIRVQMIRTLEVVKEKERENTELQEKLQQLESQLMEANRIREEASAE
TIRWKENILDQENELQNIKQENDDLQAKELAASEKVKELSFQLANVKDSLINGNTKEGDN
EKGGTEEDDEPVVVVAKMWENGKFADCDSSKEKDNDGDSQVDLESNKGDAGLDSNGLHST
NESSGRASTKQPQQHKKPLLKRFGGLLKKKSEK*

MLGSKTKSGSAEAKSNGKPDKEKKGGGGGTPPTPKDSKPRKPAVPKASAAGHGTPRAADK
SPGSGSADRKAPTPKAAASRLATTPEKGKPAKPPQEQHAQLAAIREELVKAKEQLVENEK
EKCKVFAELERAKKVADEANAKLQDALDVQRRAIEAQEADKLPARESEQASIHGQQEADD
AVLRSTVEQLEKARYELADAIDAKNEALSQVDDAVRASEVKAQEVEHLTVEVTRLKGLVD
SKVDGNRKKTAERIQNLEEENFALKLELEKKKAAEEKAVRLERMIDELKSDVDDARNFGS
KSKQLADEWQKKAQLLEVRLEEADQSNILKGESLNSAMEELDSTSSLLRDRESEVAALRD
KVRFLEDELTKLKSDIVVSGQRADAAEKETTDLWTEIEGLRLKLHTVEEEKMEALNSDKN
TSSEIETLNEQKNQLADELEASKDELEKIKKAMEGLASALQEMSAESREAQEKYLLKQDE
MERAQAQVEELNLSLKNIKENYELLLDEANYEKVCLTKAVERLEAEAKRAHEEWQSKELS
FVSSIKNSEEEIVAVRVQMDRTLEVVKEKENENTELQEKLQQLESQLMEANRIREEGNTE
TIRWKENILDQENELQNIKQENDDLQAKESAASEKIKELSSQLTNAKDGTINSNTKDGDN
EKGGTEEDDEPVVVVAKMWENSKFADYDSAKEENDGDSQVDLESNKGDAGLDSNGLHSTK
ENSGRASPTKQHQQYKKKPLLKRFGGLLKKKSEN*

Other information
Ka divergence:-0.341386KaKs divergence:-0.254906
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):2262Length 2 (bp):2265Length divergence:0.001
MFE 1 (kcal):-772.39MFE 2 (kcal):-755.52MFE divergence-0.011