Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G358830-GRMZM2G470499
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279767 (LOC100279767), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1647597190694
Log2 mRNA fold difference:4.5936086537748
Log2 TE fold difference:-5.6619649508786
Sequences
Protein sequence

MSSPAPTSPATPSPPPPAPVPPTPSPQPPTPAPVPPTPAPVPPTPAPVPPTPAPIPPTPA
PVPPTPTPSPPPPSPSPPPPVTPSPPPPATVPTPSPPPPASPPPPTVPTPSPTPPASPPP
PATAPTPTPPPPVLRPPPPSAVPASPPPPDSVPSPPPSPNGVPASPASPPSHQLLAPPPP
ASSTGTSSTSSSPSKSSSNATVVGIGVAVGAVVLIGLAVGLIYCFAGRKRRRRSPLPSQG
FPGEFYDPRRGPMTPLHMSHVQSTTPSSTPPLMHSWQQSSHGLSESPLPPLNPSPAITGG
TFAYDDLAAATDGFSDANLLGQGGFGHVYRGTVAGQEVAIKKLRAGSGQGDREFRAEVEI
ISRVHHKNLVSLVGYCLHGEQRLLVYEYVPNKTLEFQLHGSGRPTLDWPRRWKIAVGSAK
GLAYLHEDCHPKIIHRDIKAANILLDYNYEPKVADFGLAKYQAAEVTSVSTRVMGTFGYL
APEYAATGKVNDRSDVFSFGVMLLELITGRKPIMTSSEYQPETLVSWARPLLTRAVEEEN
YDELIDPRLETNYDAYDMARLVACAAAAVRQTARSRPRMSQVRLLLQNVSHTLGAAVAAS
VTLVSPFPNGQVVRYLEGELSVEDLNAGVMPGQSAMQRSSGGTTDQINRLRRMAFGPGAG
GSTGTGAITEYTSSEFSDPTTEYGLNPSSEYTASSAGDTGEVAAGAQGQQQWHGRRAPGD
TERMSRRTTGRRTQS*

MTPPPNLSPAPAITGGTFAYDDLAAATGRFSDANLLGQGGFGHVYRGTVGGREVAIKKLQ
AGGGQGDREFRAEVEIISRVHHKNLVSLVGYCLYGEQRLLVYEYVPNKTLEFHLHGTGSG
RPTLDWPRRWRIAVGSAKGLAYLHEDCYPKIIHRDIKAANILLDYHYEPKVADFGLAKYQ
AAEVTPVSTRVIGTFGYLAPEYAATGKISDRSDVFSFGVMLLELITGRKPIMASSEFQSV
ALVSWARPLLTRAVEEENYDDLIDPRLETDYDAHDMARLVACAAAAVRQTARCRPRMSQI
VRYLEGELSVEDLNAGVVPGQSAVQRSGGGTTDRISRLGRVREHRDRDDHHGVHEQRSHQ
RGRGRHGRGGGRAGAAVLRQARGRLHREDEPAHHRQTHPEFVVRSRTSAY*

Other information
Ka divergence:0.867141KaKs divergence:0.664263
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):2208Length 2 (bp):1233Length divergence:-0.283
MFE 1 (kcal):-960.8MFE 2 (kcal):-564.8MFE divergence-0.26