Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G359234-GRMZM2G370048
Species:maize
Duplication type:WGD
Function (paralog1):UDP-glucuronic acid decarboxylase 1
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5994566629381
Log2 mRNA fold difference:-1.7783623967933
Log2 TE fold difference:0.18066725777245
Sequences
Protein sequence

MQPCAVPLVYSSSLSTFPHTHQATTRSPTTHAPPPARSPAMKQLHKSSPTHAPSPAHAPA
PKAAKTARPGPRSWIGYVLREQRLLFVLLGALIASTFFLLRPYLSLSPSSHLPDARPLFS
FATRSGVPAGFRPPQRRVVVTGGAGFVGSHLVDRLLEQGDSVIVVDNFFTGRKENVAHHL
RNPRFELLRHDVVEPILLEVDRIYHLACPASPVHYKYNPIKTIKTNVMGTLNMLGLAKRI
GARFLLTSTSEVYGDPLEHPQKESYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGGGVEV
RIARIFNTYGPRMCLDDGRVVSNFVAQALRRQPMTVYGDGKQTRSFQYVADLVAGLMALM
ESDHIGPFNLGNPGEFTMLELAQVVKETIDPMATIEFKPNTADDPHMRKPDITKAKQLLH
WEPKVSLKEGLPLMVQDFRQRISDE*

MKQLHKSSPTQAPSPAHAPAPKAAKPARPGPRSWIGYILREQRLLFVLLGALIATTFFLI
RPYFSLSPSSHLPDVRPLFSFAARSAVPPGFRPPPRRVVVTGGAGFVGSHLVDRLLEQGD
SVIVVDNFFTGRKENVAHHLRNPRFELLRHDVVEPILLEVDRIYHLACPASPVHYKYNPI
KTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGDPLEHPQKESYWGHVNPIGVRSCYDE
GKRTAETSTMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQALRRQPMTVYGDG
KQTRSFQYVSDLVAGLMALMESDHIGPFNLGNPGEFTMLELAQVVKETIDPMATIEFKPN
TADDPHMRKPDITKAKQLLHWEPNVSLREGLPLMVKDFRQRISDE*

Other information
Ka divergence:0.519268KaKs divergence:0.421924
GC content 1 (%):56GC content 2 (%):55GC content divergence:-0.009
Length 1 (bp):1338Length 2 (bp):1218Length divergence:-0.047
MFE 1 (kcal):-478.32MFE 2 (kcal):-428.14MFE divergence-0.055