Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G360021-GRMZM5G826801
Species:maize
Duplication type:WGD
Function (paralog1):50S ribosomal protein L12-1
Function (paralog2):hypothetical protein LOC100280337 (LOC100280337), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0628704369199
Log2 mRNA fold difference:-1.9780450647434
Log2 TE fold difference:-0.092331668665466
Sequences
Protein sequence

MASTTLSSAFTLLSRPSTSPCPAASLPRSSHAAPHIRRGRRAVAVACTATESPKILELGD
AIAGLTLEEARSLVDHLQERLGVTAAAFAPAAVVAAPGAGGGAAAEEEAPVEKTEFDVMI
EEVPSSARIATIKVVRALTSLALKEAKDLIEGLPKKVKEAVSKDEAEDAKKQLEEVGAKV
SIA*

MASTTLSSAFSLLSRPSTSPCPAVSLPRSSFPVPDSRRRRRAVTVASTATESPKVLELGD
TIAGLTLEEARNLVDHLQERLGVTAAAFAPAAVVAAPGAGGGAAAEEEAPVEKTEFDVVI
EEVPSSARIATIKVVRVLTSLALKEAKDLIEGLPKKLKEAVSKDEAEDAKKQLEEVGAKV
SIV*

Other information
Ka divergence:0.0773006KaKs divergence:-0.246349
GC content 1 (%):72GC content 2 (%):68GC content divergence:-0.029
Length 1 (bp):552Length 2 (bp):552Length divergence:0
MFE 1 (kcal):-277.6MFE 2 (kcal):-261.1MFE divergence-0.031